Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2995874..2996790 | Replicon | chromosome |
Accession | NZ_CP121861 | ||
Organism | Bacillus stercoris strain Mal05 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QA442_RS15570 | Protein ID | WP_095431469.1 |
Coordinates | 2995874..2996620 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4NV07 |
Locus tag | QA442_RS15575 | Protein ID | WP_003239095.1 |
Coordinates | 2996620..2996790 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA442_RS15545 (2990956) | 2990956..2991102 | - | 147 | WP_141237713.1 | hypothetical protein | - |
QA442_RS15550 (2991202) | 2991202..2992152 | - | 951 | WP_095431468.1 | ring-cleaving dioxygenase | - |
QA442_RS15555 (2992540) | 2992540..2993856 | + | 1317 | WP_014663668.1 | serine/threonine exchanger | - |
QA442_RS15560 (2994133) | 2994133..2994750 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QA442_RS15565 (2994763) | 2994763..2995764 | + | 1002 | WP_014663667.1 | inorganic phosphate transporter | - |
QA442_RS15570 (2995874) | 2995874..2996620 | + | 747 | WP_095431469.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QA442_RS15575 (2996620) | 2996620..2996790 | + | 171 | WP_003239095.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QA442_RS15580 (2996876) | 2996876..2997013 | + | 138 | WP_136654612.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QA442_RS15585 (2997051) | 2997051..2997944 | - | 894 | WP_095431470.1 | N-acetylmuramoyl-L-alanine amidase | - |
QA442_RS15590 (2997957) | 2997957..2998220 | - | 264 | WP_003232653.1 | phage holin | - |
QA442_RS15595 (2998233) | 2998233..2998502 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
QA442_RS15600 (2998555) | 2998555..2999394 | - | 840 | WP_095431471.1 | phage portal protein | - |
QA442_RS15605 (2999439) | 2999439..2999603 | - | 165 | WP_040083360.1 | XkdX family protein | - |
QA442_RS15610 (2999600) | 2999600..2999929 | - | 330 | WP_040083361.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29070.57 Da Isoelectric Point: 4.6145
>T276599 WP_095431469.1 NZ_CP121861:2995874-2996620 [Bacillus stercoris]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWDRYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CQYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKMVLIPFTIETKNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWDRYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CQYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKMVLIPFTIETKNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|