Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 43846..44602 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP121796 | ||
| Organism | Aeromonas hydrophila strain YURI 17 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QBS06_RS00220 | Protein ID | WP_279448636.1 |
| Coordinates | 43846..44043 (+) | Length | 66 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QBS06_RS00225 | Protein ID | WP_279448405.1 |
| Coordinates | 44189..44602 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBS06_RS00185 | 39920..40528 | - | 609 | WP_279448620.1 | Ig-like domain-containing protein | - |
| QBS06_RS00190 | 40582..40914 | - | 333 | WP_279448622.1 | hypothetical protein | - |
| QBS06_RS00195 | 40847..42061 | - | 1215 | WP_279448624.1 | hypothetical protein | - |
| QBS06_RS00200 | 42021..42254 | - | 234 | WP_279448627.1 | hypothetical protein | - |
| QBS06_RS00205 | 42561..42911 | + | 351 | WP_279448629.1 | chromosome segregation protein ParM | - |
| QBS06_RS00210 | 43048..43347 | + | 300 | WP_279448632.1 | type II toxin-antitoxin system HigB family toxin | - |
| QBS06_RS00215 | 43349..43705 | + | 357 | Protein_42 | transcriptional regulator | - |
| QBS06_RS00220 | 43846..44043 | + | 198 | WP_279448636.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QBS06_RS00225 | 44189..44602 | + | 414 | WP_279448405.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QBS06_RS00230 | 44630..45142 | - | 513 | WP_279448408.1 | hypothetical protein | - |
| QBS06_RS00235 | 45508..45888 | - | 381 | WP_279448410.1 | hypothetical protein | - |
| QBS06_RS00240 | 46184..46339 | - | 156 | WP_279448412.1 | hypothetical protein | - |
| QBS06_RS00245 | 46329..46880 | - | 552 | WP_279448414.1 | phage baseplate assembly protein V | - |
| QBS06_RS00250 | 46877..47053 | - | 177 | WP_279448417.1 | hypothetical protein | - |
| QBS06_RS00255 | 47144..48061 | - | 918 | WP_279448419.1 | hypothetical protein | - |
| QBS06_RS00260 | 48058..48813 | - | 756 | WP_279448421.1 | hypothetical protein | - |
| QBS06_RS00265 | 48803..49360 | - | 558 | WP_279448423.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..87046 | 87046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 66 a.a. Molecular weight: 7380.35 Da Isoelectric Point: 9.7708
>T276576 WP_279448636.1 NZ_CP121796:43846-44043 [Aeromonas hydrophila]
VNEEATLTSSALIKLLEENGWVWERTKGSHHQYKKEGFSFVITVPHPTKDIKIGTLKKNNEASRS
VNEEATLTSSALIKLLEENGWVWERTKGSHHQYKKEGFSFVITVPHPTKDIKIGTLKKNNEASRS
Download Length: 198 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15280.02 Da Isoelectric Point: 4.4353
>AT276576 WP_279448405.1 NZ_CP121796:44189-44602 [Aeromonas hydrophila]
MYYYPAYIHQDEDGSASGFFPGVDGCFFAGNTLEECMEDARGALDAHFEFMADEGLQIPAATKVSEHSKDEECKDGFWVM
VEIDTSKFEGDIKRINITLPENLIGKIDNRVSSEGKRYASRSAFIAAAARELLQRHA
MYYYPAYIHQDEDGSASGFFPGVDGCFFAGNTLEECMEDARGALDAHFEFMADEGLQIPAATKVSEHSKDEECKDGFWVM
VEIDTSKFEGDIKRINITLPENLIGKIDNRVSSEGKRYASRSAFIAAAARELLQRHA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|