Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1993252..1993832 | Replicon | chromosome |
Accession | NZ_CP121769 | ||
Organism | Glaesserella parasuis strain Z44 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A143CFE3 |
Locus tag | QBL01_RS09905 | Protein ID | WP_005710599.1 |
Coordinates | 1993488..1993832 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U4SAI4 |
Locus tag | QBL01_RS09900 | Protein ID | WP_005710601.1 |
Coordinates | 1993252..1993491 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBL01_RS09875 (QBL01_09875) | 1988956..1989648 | - | 693 | WP_021118715.1 | tellurite resistance TerB family protein | - |
QBL01_RS09880 (QBL01_09880) | 1989710..1990558 | - | 849 | WP_279378418.1 | ABC transporter permease subunit | - |
QBL01_RS09885 (QBL01_09885) | 1990555..1991340 | - | 786 | WP_279378419.1 | ABC transporter permease subunit | - |
QBL01_RS09890 (QBL01_09890) | 1991330..1992079 | - | 750 | WP_279378420.1 | phosphonate ABC transporter ATP-binding protein | - |
QBL01_RS09895 (QBL01_09895) | 1992191..1993066 | - | 876 | WP_279378421.1 | putative selenate ABC transporter substrate-binding protein | - |
QBL01_RS09900 (QBL01_09900) | 1993252..1993491 | + | 240 | WP_005710601.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QBL01_RS09905 (QBL01_09905) | 1993488..1993832 | + | 345 | WP_005710599.1 | endoribonuclease MazF | Toxin |
QBL01_RS09910 (QBL01_09910) | 1993838..1994506 | + | 669 | WP_021118711.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
QBL01_RS09915 (QBL01_09915) | 1994519..1995910 | + | 1392 | WP_279378422.1 | MATE family efflux transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12830.81 Da Isoelectric Point: 7.9277
>T276570 WP_005710599.1 NZ_CP121769:1993488-1993832 [Glaesserella parasuis]
MTTQEYIPDVGDIIWLDFDPQAGHEQAGHRPALVLTPTIYNRQTGLLICCPLTTKVKGYPFEVNIAGTPQNVVLSDQIKS
LDWRIRHAKFKGKINHHQLSEVKAKIATLLQISE
MTTQEYIPDVGDIIWLDFDPQAGHEQAGHRPALVLTPTIYNRQTGLLICCPLTTKVKGYPFEVNIAGTPQNVVLSDQIKS
LDWRIRHAKFKGKINHHQLSEVKAKIATLLQISE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A143CFE3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U4SAI4 |