Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 1915224..1915759 | Replicon | chromosome |
| Accession | NZ_CP121769 | ||
| Organism | Glaesserella parasuis strain Z44 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A837AG59 |
| Locus tag | QBL01_RS09510 | Protein ID | WP_010785923.1 |
| Coordinates | 1915224..1915508 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A837AF96 |
| Locus tag | QBL01_RS09515 | Protein ID | WP_021118772.1 |
| Coordinates | 1915505..1915759 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBL01_RS09485 (QBL01_09485) | 1910370..1910861 | + | 492 | WP_005712683.1 | acetolactate synthase small subunit | - |
| QBL01_RS09490 (QBL01_09490) | 1910968..1911789 | - | 822 | WP_042906514.1 | PHP domain-containing protein | - |
| QBL01_RS09495 (QBL01_09495) | 1911790..1912386 | - | 597 | WP_020996918.1 | uracil DNA glycosylase superfamily protein | - |
| QBL01_RS09500 (QBL01_09500) | 1912421..1913380 | - | 960 | WP_021117960.1 | S-adenosyl-l-methionine hydroxide adenosyltransferase family protein | - |
| QBL01_RS09505 (QBL01_09505) | 1913463..1915013 | - | 1551 | WP_021112100.1 | exodeoxyribonuclease I | - |
| QBL01_RS09510 (QBL01_09510) | 1915224..1915508 | - | 285 | WP_010785923.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBL01_RS09515 (QBL01_09515) | 1915505..1915759 | - | 255 | WP_021118772.1 | hypothetical protein | Antitoxin |
| QBL01_RS09520 (QBL01_09520) | 1915876..1916631 | - | 756 | WP_160444822.1 | ABC transporter permease | - |
| QBL01_RS09525 (QBL01_09525) | 1916653..1917549 | - | 897 | WP_005712691.1 | ABC transporter ATP-binding protein | - |
| QBL01_RS09530 (QBL01_09530) | 1917697..1917864 | - | 168 | Protein_1860 | ATP-binding cassette domain-containing protein | - |
| QBL01_RS09535 (QBL01_09535) | 1917870..1919882 | - | 2013 | WP_160444821.1 | DNA polymerase III subunit gamma/tau | - |
| QBL01_RS09540 (QBL01_09540) | 1919969..1920511 | - | 543 | WP_021112096.1 | adenine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11233.25 Da Isoelectric Point: 10.5362
>T276569 WP_010785923.1 NZ_CP121769:c1915508-1915224 [Glaesserella parasuis]
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVALGK
RERNDVYQKAQLRL
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVALGK
RERNDVYQKAQLRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837AG59 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837AF96 |