Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1423979..1424607 Replicon chromosome
Accession NZ_CP121769
Organism Glaesserella parasuis strain Z44

Toxin (Protein)


Gene name hicA Uniprot ID U4SJQ6
Locus tag QBL01_RS07315 Protein ID WP_005714427.1
Coordinates 1424425..1424607 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID U4SMI8
Locus tag QBL01_RS07310 Protein ID WP_021110735.1
Coordinates 1423979..1424386 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBL01_RS07275 (QBL01_07275) 1419863..1420546 - 684 WP_160437194.1 S24 family peptidase -
QBL01_RS07280 (QBL01_07280) 1420677..1420877 + 201 WP_016527563.1 YdaS family helix-turn-helix protein -
QBL01_RS07285 (QBL01_07285) 1420898..1421119 + 222 WP_232422209.1 hypothetical protein -
QBL01_RS07290 (QBL01_07290) 1421219..1421908 + 690 WP_234921616.1 phage regulatory protein/antirepressor Ant -
QBL01_RS07295 (QBL01_07295) 1421905..1422645 + 741 WP_160448333.1 replication protein -
QBL01_RS07300 (QBL01_07300) 1422663..1423261 + 599 Protein_1415 replication protein P -
QBL01_RS07305 (QBL01_07305) 1423517..1423945 + 429 WP_021110736.1 recombination protein NinB -
QBL01_RS07310 (QBL01_07310) 1423979..1424386 - 408 WP_021110735.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QBL01_RS07315 (QBL01_07315) 1424425..1424607 - 183 WP_005714427.1 type II toxin-antitoxin system HicA family toxin Toxin
QBL01_RS07320 (QBL01_07320) 1424698..1424988 + 291 WP_021110734.1 DUF1364 domain-containing protein -
QBL01_RS07325 (QBL01_07325) 1424985..1425389 + 405 WP_021116921.1 RusA family crossover junction endodeoxyribonuclease -
QBL01_RS07330 (QBL01_07330) 1425386..1425763 + 378 WP_160448330.1 ECF-type sigma factor -
QBL01_RS07335 (QBL01_07335) 1425772..1425957 - 186 WP_021116919.1 hypothetical protein -
QBL01_RS07340 (QBL01_07340) 1426509..1427333 + 825 WP_075604580.1 phage antirepressor N-terminal domain-containing protein -
QBL01_RS07345 (QBL01_07345) 1427825..1428124 + 300 WP_075593097.1 hypothetical protein -
QBL01_RS07350 (QBL01_07350) 1428099..1428644 + 546 WP_075604581.1 lysozyme -
QBL01_RS07355 (QBL01_07355) 1428617..1428961 + 345 WP_075604582.1 DUF2570 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1352057..1437560 85503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6803.94 Da        Isoelectric Point: 10.7158

>T276567 WP_005714427.1 NZ_CP121769:c1424607-1424425 [Glaesserella parasuis]
VDSETMIKLLKKNGWELDSIVGSHHHFEKKNQKGAGKVTVPHPRKDLGFLEKKIRKQAGL

Download         Length: 183 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14904.94 Da        Isoelectric Point: 4.6143

>AT276567 WP_021110735.1 NZ_CP121769:c1424386-1423979 [Glaesserella parasuis]
MLYPLIFEQVSDGYVVAIPDIDGCYSAGDTLEETYSNVKQAIALHLESVVKDGGEIPTPTAIENHKNDPDLDGHNVFFGV
VDVDLSHLMGKAEKINITLPSYLIKRIDDFVAVHKEYKNRSNFLAKIAADKILTA

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U4SJQ6

Antitoxin

Source ID Structure
AlphaFold DB U4SMI8

References