Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1122958..1123735 | Replicon | chromosome |
| Accession | NZ_CP121769 | ||
| Organism | Glaesserella parasuis strain Z44 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A836YXW5 |
| Locus tag | QBL01_RS05590 | Protein ID | WP_016527794.1 |
| Coordinates | 1122958..1123458 (-) | Length | 167 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | U4SPD7 |
| Locus tag | QBL01_RS05595 | Protein ID | WP_005710653.1 |
| Coordinates | 1123448..1123735 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBL01_RS05555 (QBL01_05555) | 1118084..1118239 | - | 156 | WP_021111605.1 | YoaH family protein | - |
| QBL01_RS05560 (QBL01_05560) | 1118257..1118985 | - | 729 | WP_279378683.1 | tRNA pseudouridine(65) synthase TruC | - |
| QBL01_RS05565 (QBL01_05565) | 1118982..1119296 | - | 315 | WP_005710664.1 | YqcC family protein | - |
| QBL01_RS05570 (QBL01_05570) | 1119338..1120252 | - | 915 | WP_279378684.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| QBL01_RS05575 (QBL01_05575) | 1120264..1121379 | - | 1116 | WP_016527792.1 | anhydro-N-acetylmuramic acid kinase | - |
| QBL01_RS05580 (QBL01_05580) | 1121533..1121868 | - | 336 | WP_016527793.1 | outer membrane protein assembly factor BamE | - |
| QBL01_RS05585 (QBL01_05585) | 1121929..1122930 | - | 1002 | WP_010786647.1 | nucleoid-associated protein YejK | - |
| QBL01_RS05590 (QBL01_05590) | 1122958..1123458 | - | 501 | WP_016527794.1 | GNAT family N-acetyltransferase | Toxin |
| QBL01_RS05595 (QBL01_05595) | 1123448..1123735 | - | 288 | WP_005710653.1 | DUF1778 domain-containing protein | Antitoxin |
| QBL01_RS05600 (QBL01_05600) | 1123881..1124270 | + | 390 | WP_021116694.1 | RidA family protein | - |
| QBL01_RS05605 (QBL01_05605) | 1124274..1125011 | + | 738 | WP_021109669.1 | peptidoglycan editing factor PgeF | - |
| QBL01_RS05610 (QBL01_05610) | 1125186..1126763 | + | 1578 | WP_021116696.1 | FAD-binding protein | - |
| QBL01_RS05615 (QBL01_05615) | 1126867..1127367 | + | 501 | WP_021115009.1 | CvpA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 19081.26 Da Isoelectric Point: 9.2835
>T276565 WP_016527794.1 NZ_CP121769:c1123458-1122958 [Glaesserella parasuis]
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYYPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVGGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYYPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVGGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836YXW5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U4SPD7 |