Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2035447..2036053 | Replicon | chromosome |
Accession | NZ_CP121768 | ||
Organism | Glaesserella parasuis strain d76 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QBK97_RS10015 | Protein ID | WP_021114171.1 |
Coordinates | 2035447..2035764 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QBK97_RS10020 | Protein ID | WP_021114170.1 |
Coordinates | 2035766..2036053 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBK97_RS09985 (QBK97_09985) | 2032259..2033116 | - | 858 | WP_075630627.1 | DUF1837 domain-containing protein | - |
QBK97_RS09990 (QBK97_09990) | 2033167..2033325 | - | 159 | WP_021114175.1 | hypothetical protein | - |
QBK97_RS09995 (QBK97_09995) | 2033497..2033889 | - | 393 | WP_234885489.1 | efflux RND transporter permease subunit | - |
QBK97_RS10000 (QBK97_10000) | 2033877..2034305 | - | 429 | WP_261576990.1 | efflux RND transporter permease subunit | - |
QBK97_RS10005 (QBK97_10005) | 2034350..2034892 | - | 543 | WP_160413775.1 | efflux RND transporter permease subunit | - |
QBK97_RS10010 (QBK97_10010) | 2034832..2035230 | - | 399 | WP_075630625.1 | efflux RND transporter permease subunit | - |
QBK97_RS10015 (QBK97_10015) | 2035447..2035764 | + | 318 | WP_021114171.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QBK97_RS10020 (QBK97_10020) | 2035766..2036053 | + | 288 | WP_021114170.1 | putative addiction module antidote protein | Antitoxin |
QBK97_RS10025 (QBK97_10025) | 2036383..2036775 | - | 393 | WP_021114169.1 | acrA protein | - |
QBK97_RS10030 (QBK97_10030) | 2036830..2036979 | - | 150 | WP_231401366.1 | hypothetical protein | - |
QBK97_RS10035 (QBK97_10035) | 2037006..2037278 | - | 273 | WP_231401367.1 | hypothetical protein | - |
QBK97_RS10040 (QBK97_10040) | 2037473..2038624 | - | 1152 | WP_234888060.1 | restriction endonuclease subunit S | - |
QBK97_RS10045 (QBK97_10045) | 2038564..2039130 | - | 567 | WP_234885490.1 | N-6 DNA methylase | - |
QBK97_RS10050 (QBK97_10050) | 2039229..2040608 | - | 1380 | WP_234885491.1 | N-6 DNA methylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11965.65 Da Isoelectric Point: 9.3816
>T276563 WP_021114171.1 NZ_CP121768:2035447-2035764 [Glaesserella parasuis]
MNVIETTLIFDEWLDNLKDLRAKIQIVTRIRRAENGNFGDHKPLPNTGGVSEIRLDIGKGYRIYYGQIGEITYILTNGGD
KSSQQADIEKAKALFVQIKQQKKEQ
MNVIETTLIFDEWLDNLKDLRAKIQIVTRIRRAENGNFGDHKPLPNTGGVSEIRLDIGKGYRIYYGQIGEITYILTNGGD
KSSQQADIEKAKALFVQIKQQKKEQ
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|