Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1297575..1298352 | Replicon | chromosome |
Accession | NZ_CP121768 | ||
Organism | Glaesserella parasuis strain d76 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A836YXW5 |
Locus tag | QBK97_RS06275 | Protein ID | WP_016527794.1 |
Coordinates | 1297852..1298352 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | - |
Locus tag | QBK97_RS06270 | Protein ID | WP_026916906.1 |
Coordinates | 1297575..1297862 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBK97_RS06250 (QBK97_06250) | 1293942..1294442 | - | 501 | WP_021109667.1 | CvpA family protein | - |
QBK97_RS06255 (QBK97_06255) | 1294547..1296124 | - | 1578 | WP_279368212.1 | FAD-binding protein | - |
QBK97_RS06260 (QBK97_06260) | 1296299..1297036 | - | 738 | WP_021112465.1 | peptidoglycan editing factor PgeF | - |
QBK97_RS06265 (QBK97_06265) | 1297040..1297429 | - | 390 | WP_279368213.1 | RidA family protein | - |
QBK97_RS06270 (QBK97_06270) | 1297575..1297862 | + | 288 | WP_026916906.1 | DUF1778 domain-containing protein | Antitoxin |
QBK97_RS06275 (QBK97_06275) | 1297852..1298352 | + | 501 | WP_016527794.1 | GNAT family N-acetyltransferase | Toxin |
QBK97_RS06280 (QBK97_06280) | 1298380..1299381 | + | 1002 | WP_010786647.1 | nucleoid-associated protein YejK | - |
QBK97_RS06285 (QBK97_06285) | 1299442..1299777 | + | 336 | WP_016527793.1 | outer membrane protein assembly factor BamE | - |
QBK97_RS06290 (QBK97_06290) | 1299931..1301046 | + | 1116 | WP_016527792.1 | anhydro-N-acetylmuramic acid kinase | - |
QBK97_RS06295 (QBK97_06295) | 1301058..1301972 | + | 915 | WP_021113663.1 | N-acetylmuramic acid 6-phosphate etherase | - |
QBK97_RS06300 (QBK97_06300) | 1302014..1302328 | + | 315 | WP_005710664.1 | YqcC family protein | - |
QBK97_RS06305 (QBK97_06305) | 1302325..1303053 | + | 729 | WP_021112446.1 | tRNA pseudouridine(65) synthase TruC | - |
QBK97_RS06310 (QBK97_06310) | 1303071..1303226 | + | 156 | WP_021116533.1 | YoaH family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 19081.26 Da Isoelectric Point: 9.2835
>T276562 WP_016527794.1 NZ_CP121768:1297852-1298352 [Glaesserella parasuis]
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYYPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVGGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
MKSKFIEEPLTKHHQREAFDCGNLEMNRFFKQYARQSHEKGTSKTYISRHLDSQQIIGFYTITLSALDQQHLPELCKKRF
GYYPIPLFTLARLAVDIRYQKQGIGGMLLVKALKRCAIVAEQVGGIGLLIEAKDEDISRWYQSYGAIPLENMPLTLILLF
DTIKGL
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|