Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 678550..679085 | Replicon | chromosome |
| Accession | NZ_CP121768 | ||
| Organism | Glaesserella parasuis strain d76 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A837AG59 |
| Locus tag | QBK97_RS03455 | Protein ID | WP_010785923.1 |
| Coordinates | 678801..679085 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A837AF96 |
| Locus tag | QBK97_RS03450 | Protein ID | WP_021118772.1 |
| Coordinates | 678550..678804 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBK97_RS03430 (QBK97_03430) | 674105..674647 | + | 543 | WP_010785927.1 | adenine phosphoribosyltransferase | - |
| QBK97_RS03435 (QBK97_03435) | 674736..676754 | + | 2019 | WP_160429885.1 | DNA polymerase III subunit gamma/tau | - |
| QBK97_RS03440 (QBK97_03440) | 676760..677656 | + | 897 | WP_005712691.1 | ABC transporter ATP-binding protein | - |
| QBK97_RS03445 (QBK97_03445) | 677678..678433 | + | 756 | WP_021112098.1 | ABC transporter permease | - |
| QBK97_RS03450 (QBK97_03450) | 678550..678804 | + | 255 | WP_021118772.1 | hypothetical protein | Antitoxin |
| QBK97_RS03455 (QBK97_03455) | 678801..679085 | + | 285 | WP_010785923.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBK97_RS03460 (QBK97_03460) | 679295..680845 | + | 1551 | WP_010785922.1 | exodeoxyribonuclease I | - |
| QBK97_RS03465 (QBK97_03465) | 680928..681887 | + | 960 | WP_005712686.1 | S-adenosyl-l-methionine hydroxide adenosyltransferase family protein | - |
| QBK97_RS03470 (QBK97_03470) | 681922..682518 | + | 597 | WP_020996918.1 | uracil DNA glycosylase superfamily protein | - |
| QBK97_RS03475 (QBK97_03475) | 682519..683340 | + | 822 | WP_021116604.1 | PHP domain-containing protein | - |
| QBK97_RS03480 (QBK97_03480) | 683447..683938 | - | 492 | WP_005712683.1 | acetolactate synthase small subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11233.25 Da Isoelectric Point: 10.5362
>T276559 WP_010785923.1 NZ_CP121768:678801-679085 [Glaesserella parasuis]
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVALGK
RERNDVYQKAQLRL
MSYTIEFIPSAEKEFRKLSLDLRKQFIEKLKERAENPRVESAKLRGMKDCYKIKLRNAGYRLVYQVIDERIVIKVVALGK
RERNDVYQKAQLRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837AG59 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837AF96 |