Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 594249..594829 | Replicon | chromosome |
Accession | NZ_CP121768 | ||
Organism | Glaesserella parasuis strain d76 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U4SBB4 |
Locus tag | QBK97_RS03060 | Protein ID | WP_021113409.1 |
Coordinates | 594249..594593 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U4SAI4 |
Locus tag | QBK97_RS03065 | Protein ID | WP_005710601.1 |
Coordinates | 594590..594829 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBK97_RS03050 (QBK97_03050) | 592171..593562 | - | 1392 | WP_021116571.1 | MATE family efflux transporter | - |
QBK97_RS03055 (QBK97_03055) | 593575..594243 | - | 669 | WP_010785979.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
QBK97_RS03060 (QBK97_03060) | 594249..594593 | - | 345 | WP_021113409.1 | endoribonuclease MazF | Toxin |
QBK97_RS03065 (QBK97_03065) | 594590..594829 | - | 240 | WP_005710601.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QBK97_RS03070 (QBK97_03070) | 595015..595890 | + | 876 | WP_021113313.1 | putative selenate ABC transporter substrate-binding protein | - |
QBK97_RS03075 (QBK97_03075) | 596002..596751 | + | 750 | WP_005710605.1 | phosphonate ABC transporter ATP-binding protein | - |
QBK97_RS03080 (QBK97_03080) | 596741..597526 | + | 786 | WP_160427666.1 | ABC transporter permease subunit | - |
QBK97_RS03085 (QBK97_03085) | 597523..598371 | + | 849 | WP_042905731.1 | ABC transporter permease subunit | - |
QBK97_RS03090 (QBK97_03090) | 598433..599125 | + | 693 | WP_021118715.1 | tellurite resistance TerB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12800.79 Da Isoelectric Point: 7.9277
>T276558 WP_021113409.1 NZ_CP121768:c594593-594249 [Glaesserella parasuis]
MTTQEYIPDVGDIIWLDFDPQAGHEQAGHRPALVLTPAIYNRQTGLLICCPLTTKVKGYPFEVNIAGTPQNVVLSDQIKS
LDWRIRHAKFKGKINHHQLSEVKAKIATLLQISE
MTTQEYIPDVGDIIWLDFDPQAGHEQAGHRPALVLTPAIYNRQTGLLICCPLTTKVKGYPFEVNIAGTPQNVVLSDQIKS
LDWRIRHAKFKGKINHHQLSEVKAKIATLLQISE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|