Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 380352..380991 | Replicon | chromosome |
| Accession | NZ_CP121768 | ||
| Organism | Glaesserella parasuis strain d76 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A6I4QYS7 |
| Locus tag | QBK97_RS01990 | Protein ID | WP_021114433.1 |
| Coordinates | 380656..380991 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QBK97_RS01985 | Protein ID | WP_164681833.1 |
| Coordinates | 380352..380648 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBK97_RS01960 (QBK97_01960) | 375406..376593 | + | 1188 | WP_016527483.1 | elongation factor Tu | - |
| QBK97_RS01965 (QBK97_01965) | 376956..377525 | - | 570 | WP_231401385.1 | hypothetical protein | - |
| QBK97_RS01970 (QBK97_01970) | 377706..378035 | + | 330 | Protein_371 | transposase | - |
| QBK97_RS01975 (QBK97_01975) | 378063..379189 | - | 1127 | Protein_372 | IS3 family transposase | - |
| QBK97_RS01980 (QBK97_01980) | 379290..380279 | - | 990 | WP_021116485.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
| QBK97_RS01985 (QBK97_01985) | 380352..380648 | - | 297 | WP_164681833.1 | putative addiction module antidote protein | Antitoxin |
| QBK97_RS01990 (QBK97_01990) | 380656..380991 | - | 336 | WP_021114433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBK97_RS01995 (QBK97_01995) | 381150..381554 | + | 405 | WP_021110905.1 | DNA polymerase III subunit psi | - |
| QBK97_RS02000 (QBK97_02000) | 381669..381980 | + | 312 | WP_042906459.1 | hypothetical protein | - |
| QBK97_RS02005 (QBK97_02005) | 382074..383012 | + | 939 | WP_160427824.1 | oligoendopeptidase F family protein | - |
| QBK97_RS02010 (QBK97_02010) | 383104..383847 | + | 744 | Protein_379 | IS481 family transposase | - |
| QBK97_RS02015 (QBK97_02015) | 384036..384221 | - | 186 | WP_005713975.1 | zf-HC2 domain-containing protein | - |
| QBK97_RS02020 (QBK97_02020) | 384218..384790 | - | 573 | WP_035522608.1 | sigma-70 family RNA polymerase sigma factor | - |
| QBK97_RS02025 (QBK97_02025) | 384932..385261 | + | 330 | WP_021113605.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 377706..389384 | 11678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12079.77 Da Isoelectric Point: 9.8168
>T276556 WP_021114433.1 NZ_CP121768:c380991-380656 [Glaesserella parasuis]
MSGIINQIVITDNFSKWLDGLKNPIAKATVARRIKNAVKGNFGDHKALAGTGGLYEMRIATGAGYRIYYAQQGDVIYILL
QGGDKSTQQADIEKAKALWAELKQTGGSNEY
MSGIINQIVITDNFSKWLDGLKNPIAKATVARRIKNAVKGNFGDHKALAGTGGLYEMRIATGAGYRIYYAQQGDVIYILL
QGGDKSTQQADIEKAKALWAELKQTGGSNEY
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|