Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 6487002..6487507 | Replicon | chromosome |
| Accession | NZ_CP121766 | ||
| Organism | Pseudomonas aeruginosa strain 22112 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | QAY87_RS30470 | Protein ID | WP_003083773.1 |
| Coordinates | 6487002..6487283 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
| Locus tag | QAY87_RS30475 | Protein ID | WP_003137009.1 |
| Coordinates | 6487280..6487507 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAY87_RS30445 (QAY87_30430) | 6482253..6483602 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| QAY87_RS30450 (QAY87_30435) | 6483651..6484337 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| QAY87_RS30455 (QAY87_30440) | 6484438..6485172 | + | 735 | WP_023107524.1 | GntR family transcriptional regulator | - |
| QAY87_RS30460 (QAY87_30445) | 6485352..6485762 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| QAY87_RS30465 (QAY87_30450) | 6485794..6486702 | - | 909 | WP_023436116.1 | LysR family transcriptional regulator | - |
| QAY87_RS30470 (QAY87_30455) | 6487002..6487283 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| QAY87_RS30475 (QAY87_30460) | 6487280..6487507 | - | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QAY87_RS30480 (QAY87_30465) | 6487683..6488303 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| QAY87_RS30485 (QAY87_30470) | 6488404..6488904 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| QAY87_RS30490 (QAY87_30475) | 6488977..6489318 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| QAY87_RS30495 (QAY87_30480) | 6489403..6490830 | - | 1428 | WP_023436115.1 | GABA permease | - |
| QAY87_RS30500 (QAY87_30485) | 6490999..6492492 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | aph(6)-Id / aph(3'')-Ib / floR / sul1 / ere(A) | exoT / phzH / tagQ / tagR / tagS / tagT / ppkA / pppA / tagF/pppB / icmF1/tssM1 / dotU1 / hsiJ1 / lip1 / fha1 / hsiA1 / hsiB1/vipA / hsiC1/vipB / hcp1 / hsiE1 / hsiF1 / hsiG1 / hsiH1 / clpV1 / vgrG1a / vgrG1b / cheW | 6180221..6595403 | 415182 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T276553 WP_003083773.1 NZ_CP121766:c6487283-6487002 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|