Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 6487002..6487507 Replicon chromosome
Accession NZ_CP121766
Organism Pseudomonas aeruginosa strain 22112

Toxin (Protein)


Gene name parE Uniprot ID V6A7K8
Locus tag QAY87_RS30470 Protein ID WP_003083773.1
Coordinates 6487002..6487283 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0H2ZJU8
Locus tag QAY87_RS30475 Protein ID WP_003137009.1
Coordinates 6487280..6487507 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QAY87_RS30445 (QAY87_30430) 6482253..6483602 + 1350 WP_003137006.1 C4-dicarboxylate transporter DctA -
QAY87_RS30450 (QAY87_30435) 6483651..6484337 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
QAY87_RS30455 (QAY87_30440) 6484438..6485172 + 735 WP_023107524.1 GntR family transcriptional regulator -
QAY87_RS30460 (QAY87_30445) 6485352..6485762 + 411 WP_003110659.1 aegerolysin family protein -
QAY87_RS30465 (QAY87_30450) 6485794..6486702 - 909 WP_023436116.1 LysR family transcriptional regulator -
QAY87_RS30470 (QAY87_30455) 6487002..6487283 - 282 WP_003083773.1 type II toxin-antitoxin system toxin ParE Toxin
QAY87_RS30475 (QAY87_30460) 6487280..6487507 - 228 WP_003137009.1 CopG family ribbon-helix-helix protein Antitoxin
QAY87_RS30480 (QAY87_30465) 6487683..6488303 - 621 WP_003101226.1 hypothetical protein -
QAY87_RS30485 (QAY87_30470) 6488404..6488904 + 501 WP_003101228.1 LEA type 2 family protein -
QAY87_RS30490 (QAY87_30475) 6488977..6489318 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
QAY87_RS30495 (QAY87_30480) 6489403..6490830 - 1428 WP_023436115.1 GABA permease -
QAY87_RS30500 (QAY87_30485) 6490999..6492492 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element aph(6)-Id / aph(3'')-Ib / floR / sul1 / ere(A) exoT / phzH / tagQ / tagR / tagS / tagT / ppkA / pppA / tagF/pppB / icmF1/tssM1 / dotU1 / hsiJ1 / lip1 / fha1 / hsiA1 / hsiB1/vipA / hsiC1/vipB / hcp1 / hsiE1 / hsiF1 / hsiG1 / hsiH1 / clpV1 / vgrG1a / vgrG1b / cheW 6180221..6595403 415182


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10462.19 Da        Isoelectric Point: 10.0435

>T276553 WP_003083773.1 NZ_CP121766:c6487283-6487002 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8526.56 Da        Isoelectric Point: 5.5740

>AT276553 WP_003137009.1 NZ_CP121766:c6487507-6487280 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHAEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
PDB 6XRW

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2ZJU8

References