Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4226646..4227232 | Replicon | chromosome |
| Accession | NZ_CP121766 | ||
| Organism | Pseudomonas aeruginosa strain 22112 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | QAY87_RS20020 | Protein ID | WP_003120987.1 |
| Coordinates | 4226933..4227232 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QAY87_RS20015 | Protein ID | WP_003448662.1 |
| Coordinates | 4226646..4226936 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAY87_RS19995 (QAY87_19990) | 4222222..4224117 | + | 1896 | WP_023435882.1 | hypothetical protein | - |
| QAY87_RS20000 (QAY87_19995) | 4224114..4226090 | + | 1977 | WP_031285653.1 | DEAD/DEAH box helicase | - |
| QAY87_RS20005 (QAY87_20000) | 4226100..4226234 | + | 135 | WP_033179080.1 | hypothetical protein | - |
| QAY87_RS20010 (QAY87_20005) | 4226231..4226575 | + | 345 | WP_003448665.1 | hypothetical protein | - |
| QAY87_RS20015 (QAY87_20010) | 4226646..4226936 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| QAY87_RS20020 (QAY87_20015) | 4226933..4227232 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QAY87_RS20025 (QAY87_20020) | 4227433..4228557 | + | 1125 | WP_023435880.1 | TcpQ domain-containing protein | - |
| QAY87_RS20030 (QAY87_20025) | 4228557..4230266 | + | 1710 | WP_023435879.1 | PilN family type IVB pilus formation outer membrane protein | - |
| QAY87_RS20035 (QAY87_20030) | 4230270..4231595 | + | 1326 | WP_023435878.1 | type 4b pilus protein PilO2 | - |
| QAY87_RS20040 (QAY87_20035) | 4231585..4232118 | + | 534 | WP_023435877.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4201361..4317886 | 116525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T276551 WP_003120987.1 NZ_CP121766:c4227232-4226933 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|