Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 5450408..5450985 | Replicon | chromosome |
Accession | NZ_CP121700 | ||
Organism | Methylobacterium indicum strain JDJ13 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0J6RSB8 |
Locus tag | QBE04_RS25295 | Protein ID | WP_048425788.1 |
Coordinates | 5450692..5450985 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A0J6RRU8 |
Locus tag | QBE04_RS25290 | Protein ID | WP_048425789.1 |
Coordinates | 5450408..5450689 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBE04_RS25265 | 5446375..5446689 | - | 315 | WP_058617343.1 | hypothetical protein | - |
QBE04_RS25270 | 5446740..5447795 | - | 1056 | WP_279357215.1 | GTP-binding protein | - |
QBE04_RS25275 | 5447792..5448085 | - | 294 | WP_279357216.1 | hypothetical protein | - |
QBE04_RS25280 | 5448090..5448989 | - | 900 | WP_279357217.1 | polysaccharide deacetylase | - |
QBE04_RS25290 | 5450408..5450689 | - | 282 | WP_048425789.1 | hypothetical protein | Antitoxin |
QBE04_RS25295 | 5450692..5450985 | - | 294 | WP_048425788.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QBE04_RS25300 | 5451083..5453512 | - | 2430 | WP_279357218.1 | penicillin-binding protein 1A | - |
QBE04_RS25305 | 5453717..5455081 | - | 1365 | WP_279357219.1 | N-acetylmuramoyl-L-alanine amidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11006.62 Da Isoelectric Point: 10.4157
>T276544 WP_048425788.1 NZ_CP121700:c5450985-5450692 [Methylobacterium indicum]
MIRIRQTATFRRWEQQLKDQRARTVIAARLLRLANGLVGDAAPVGRGVSELRIHYGPGYRIYFQRRGDDIVILLCGGDKA
SQDRDIQKALQLAEEEG
MIRIRQTATFRRWEQQLKDQRARTVIAARLLRLANGLVGDAAPVGRGVSELRIHYGPGYRIYFQRRGDDIVILLCGGDKA
SQDRDIQKALQLAEEEG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J6RSB8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J6RRU8 |