Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 4426081..4426660 | Replicon | chromosome |
Accession | NZ_CP121700 | ||
Organism | Methylobacterium indicum strain JDJ13 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | QBE04_RS20450 | Protein ID | WP_279356634.1 |
Coordinates | 4426081..4426353 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | - |
Locus tag | QBE04_RS20455 | Protein ID | WP_279356635.1 |
Coordinates | 4426346..4426660 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBE04_RS20440 | 4421897..4424638 | - | 2742 | WP_279356632.1 | ATP-binding cassette domain-containing protein | - |
QBE04_RS20445 | 4425163..4425867 | + | 705 | WP_279356633.1 | carbonic anhydrase | - |
QBE04_RS20450 | 4426081..4426353 | + | 273 | WP_279356634.1 | BrnT family toxin | Toxin |
QBE04_RS20455 | 4426346..4426660 | + | 315 | WP_279356635.1 | BrnA antitoxin family protein | Antitoxin |
QBE04_RS20460 | 4426776..4428191 | + | 1416 | WP_279356636.1 | DHA2 family efflux MFS transporter permease subunit | - |
QBE04_RS20465 | 4428338..4428679 | + | 342 | WP_279356637.1 | hypothetical protein | - |
QBE04_RS20470 | 4428705..4429328 | + | 624 | WP_279356638.1 | LpxA family transferase | - |
QBE04_RS20475 | 4429372..4429779 | - | 408 | WP_279360335.1 | GNAT family N-acetyltransferase | - |
QBE04_RS20480 | 4429833..4431140 | - | 1308 | WP_279356639.1 | 2-oxo acid dehydrogenase subunit E2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10281.80 Da Isoelectric Point: 8.7076
>T276543 WP_279356634.1 NZ_CP121700:4426081-4426353 [Methylobacterium indicum]
MRIVWDEPKREMNLSKHGLDFADARDRFVFEDATILPSYPAPDGRPRFVALNDLDGRLVAVVFSPLGTQALTLISLRPAN
RKERRIFENA
MRIVWDEPKREMNLSKHGLDFADARDRFVFEDATILPSYPAPDGRPRFVALNDLDGRLVAVVFSPLGTQALTLISLRPAN
RKERRIFENA
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|