Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 3865255..3865913 | Replicon | chromosome |
| Accession | NZ_CP121700 | ||
| Organism | Methylobacterium indicum strain JDJ13 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QBE04_RS17810 | Protein ID | WP_279356347.1 |
| Coordinates | 3865509..3865913 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QBE04_RS17805 | Protein ID | WP_058618043.1 |
| Coordinates | 3865255..3865512 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBE04_RS17780 | 3860805..3861464 | + | 660 | WP_048428139.1 | GTP cyclohydrolase I FolE | - |
| QBE04_RS17785 | 3861467..3861883 | + | 417 | WP_089504160.1 | phosphoribosyl-AMP cyclohydrolase | - |
| QBE04_RS17790 | 3861933..3862349 | - | 417 | WP_048428162.1 | gamma-glutamylcyclotransferase family protein | - |
| QBE04_RS17795 | 3862360..3864363 | - | 2004 | WP_058618044.1 | acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha | - |
| QBE04_RS17800 | 3864549..3864995 | - | 447 | WP_279356346.1 | hypothetical protein | - |
| QBE04_RS17805 | 3865255..3865512 | + | 258 | WP_058618043.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QBE04_RS17810 | 3865509..3865913 | + | 405 | WP_279356347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QBE04_RS17815 | 3865991..3866440 | - | 450 | WP_279356348.1 | hypothetical protein | - |
| QBE04_RS17820 | 3866689..3867288 | - | 600 | WP_279356349.1 | L,D-transpeptidase | - |
| QBE04_RS17825 | 3867485..3868414 | + | 930 | WP_048428147.1 | histone deacetylase family protein | - |
| QBE04_RS17830 | 3868607..3869176 | - | 570 | WP_279356350.1 | hypothetical protein | - |
| QBE04_RS17835 | 3869228..3870427 | - | 1200 | WP_279356351.1 | succinyl-diaminopimelate desuccinylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14304.54 Da Isoelectric Point: 6.3492
>T276541 WP_279356347.1 NZ_CP121700:3865509-3865913 [Methylobacterium indicum]
MSGPRFLLDTNILSDLIRNPSGAVARQIARVGSKGIATSIVSVAELRYGCAKRGSARLLRQVEAVLEAIDVVPFETPADV
IYGRIRADLEAAGRPIGPNDLLIAAQALALEVPLVTANEAEFRRVGGLTVENWL
MSGPRFLLDTNILSDLIRNPSGAVARQIARVGSKGIATSIVSVAELRYGCAKRGSARLLRQVEAVLEAIDVVPFETPADV
IYGRIRADLEAAGRPIGPNDLLIAAQALALEVPLVTANEAEFRRVGGLTVENWL
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|