Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1034842..1035479 | Replicon | chromosome |
Accession | NZ_CP121700 | ||
Organism | Methylobacterium indicum strain JDJ13 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | QBE04_RS04835 | Protein ID | WP_279358388.1 |
Coordinates | 1035066..1035479 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | QBE04_RS04830 | Protein ID | WP_279358387.1 |
Coordinates | 1034842..1035069 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBE04_RS04810 | 1030368..1031738 | - | 1371 | WP_279358385.1 | ethanolamine ammonia-lyase subunit EutB | - |
QBE04_RS04815 | 1031862..1032728 | - | 867 | WP_279358386.1 | transglutaminase family protein | - |
QBE04_RS04820 | 1032901..1033119 | + | 219 | WP_048425630.1 | hypothetical protein | - |
QBE04_RS04825 | 1033676..1034695 | - | 1020 | WP_082171874.1 | SMP-30/gluconolactonase/LRE family protein | - |
QBE04_RS04830 | 1034842..1035069 | + | 228 | WP_279358387.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QBE04_RS04835 | 1035066..1035479 | + | 414 | WP_279358388.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QBE04_RS04840 | 1035501..1036571 | - | 1071 | WP_279358389.1 | malate/lactate/ureidoglycolate dehydrogenase | - |
QBE04_RS04845 | 1036826..1037986 | + | 1161 | WP_279358390.1 | ABC transporter substrate-binding protein | - |
QBE04_RS04850 | 1038095..1038970 | + | 876 | WP_048425624.1 | branched-chain amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14955.28 Da Isoelectric Point: 9.7215
>T276540 WP_279358388.1 NZ_CP121700:1035066-1035479 [Methylobacterium indicum]
VKPRYLLDTNVIIALRRRRPRSVVARLTALRIGEAVMSPVTYGELCFGAEKSVDRDNAFAVLARLVAVVPIEIPEPGETG
RRYGEIRATLGRQGQLIGNNDVWIAAHALAANLTLVTGNVGEFSRVPGLVIEDWTAH
VKPRYLLDTNVIIALRRRRPRSVVARLTALRIGEAVMSPVTYGELCFGAEKSVDRDNAFAVLARLVAVVPIEIPEPGETG
RRYGEIRATLGRQGQLIGNNDVWIAAHALAANLTLVTGNVGEFSRVPGLVIEDWTAH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|