Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 300995..301645 | Replicon | chromosome |
| Accession | NZ_CP121700 | ||
| Organism | Methylobacterium indicum strain JDJ13 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QBE04_RS01405 | Protein ID | WP_279357980.1 |
| Coordinates | 300995..301204 (+) | Length | 70 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QBE04_RS01410 | Protein ID | WP_279357981.1 |
| Coordinates | 301241..301645 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBE04_RS01385 | 296310..296963 | + | 654 | WP_048429360.1 | amino acid ABC transporter permease | - |
| QBE04_RS01390 | 296960..297760 | + | 801 | WP_279357977.1 | amino acid ABC transporter ATP-binding protein | - |
| QBE04_RS01395 | 297944..298891 | + | 948 | WP_279357978.1 | agmatinase | - |
| QBE04_RS01400 | 299161..300771 | + | 1611 | WP_279357979.1 | galactarate dehydratase | - |
| QBE04_RS01405 | 300995..301204 | + | 210 | WP_279357980.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QBE04_RS01410 | 301241..301645 | + | 405 | WP_279357981.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QBE04_RS01415 | 301679..302572 | - | 894 | WP_279357982.1 | hydroxymethylglutaryl-CoA lyase | - |
| QBE04_RS01420 | 302569..303789 | - | 1221 | WP_279357983.1 | ABC transporter substrate-binding protein | - |
| QBE04_RS01425 | 304052..305335 | - | 1284 | WP_279357984.1 | hydroxymethylglutaryl-CoA reductase, degradative | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 70 a.a. Molecular weight: 7786.92 Da Isoelectric Point: 10.7459
>T276539 WP_279357980.1 NZ_CP121700:300995-301204 [Methylobacterium indicum]
MAPKQRSRKTRDVLAMLVKDGWFVARKGPGDHVQYKHPTKPGKVTVDSGASEIPTGTLHNIYRQAGWEW
MAPKQRSRKTRDVLAMLVKDGWFVARKGPGDHVQYKHPTKPGKVTVDSGASEIPTGTLHNIYRQAGWEW
Download Length: 210 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14283.17 Da Isoelectric Point: 4.4323
>AT276539 WP_279357981.1 NZ_CP121700:301241-301645 [Methylobacterium indicum]
MVRIVMLVHEEEGVFGASFPDFPGATTVADDLDTLYRKAAEMLAFHVNGMAEDGDAIPALRTLSELQQDPVFRDDSEGAM
IGLVDVDLPGKAVRVNVSIEEGLLKRIDHAAAAAGESRSSFLARAARARLSTAA
MVRIVMLVHEEEGVFGASFPDFPGATTVADDLDTLYRKAAEMLAFHVNGMAEDGDAIPALRTLSELQQDPVFRDDSEGAM
IGLVDVDLPGKAVRVNVSIEEGLLKRIDHAAAAAGESRSSFLARAARARLSTAA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|