Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-PrlF |
| Location | 8335311..8335851 | Replicon | chromosome |
| Accession | NZ_CP121695 | ||
| Organism | Bradyrhizobium sp. CB1650 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QA641_RS39410 | Protein ID | WP_279372705.1 |
| Coordinates | 8335513..8335851 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QA641_RS39405 | Protein ID | WP_279372704.1 |
| Coordinates | 8335311..8335526 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA641_RS39390 (QA641_39390) | 8330575..8332233 | + | 1659 | WP_279372701.1 | recombinase family protein | - |
| QA641_RS39395 (QA641_39395) | 8332404..8334101 | + | 1698 | WP_279372702.1 | hypothetical protein | - |
| QA641_RS39400 (QA641_39400) | 8334851..8335210 | + | 360 | WP_279372703.1 | helix-turn-helix transcriptional regulator | - |
| QA641_RS39405 (QA641_39405) | 8335311..8335526 | + | 216 | WP_279372704.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| QA641_RS39410 (QA641_39410) | 8335513..8335851 | + | 339 | WP_279372705.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QA641_RS39415 (QA641_39415) | 8336485..8337075 | + | 591 | WP_279372706.1 | hypothetical protein | - |
| QA641_RS39420 (QA641_39420) | 8337251..8337760 | + | 510 | WP_279372707.1 | hypothetical protein | - |
| QA641_RS39425 (QA641_39425) | 8337831..8337968 | + | 138 | WP_279372708.1 | hypothetical protein | - |
| QA641_RS39430 (QA641_39430) | 8337972..8338793 | + | 822 | WP_279372709.1 | metallophosphoesterase | - |
| QA641_RS39435 (QA641_39435) | 8338883..8339191 | + | 309 | WP_279372710.1 | hypothetical protein | - |
| QA641_RS39440 (QA641_39440) | 8339626..8340366 | + | 741 | WP_279372711.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12376.26 Da Isoelectric Point: 10.4044
>T276536 WP_279372705.1 NZ_CP121695:8335513-8335851 [Bradyrhizobium sp. CB1650]
MPPFRQGDVVRVPFPYTDRSTRQHRPALVVSTGGIGENENLIWVVMITSAENRTWPGDLAIGRYEEAGLPAPSIIRSCKI
ATIEARHAERLGRIKPRLTTEVVSAIRSILGS
MPPFRQGDVVRVPFPYTDRSTRQHRPALVVSTGGIGENENLIWVVMITSAENRTWPGDLAIGRYEEAGLPAPSIIRSCKI
ATIEARHAERLGRIKPRLTTEVVSAIRSILGS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|