Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | rlegTA/AbiEii-AbiEi |
Location | 8036608..8038126 | Replicon | chromosome |
Accession | NZ_CP121695 | ||
Organism | Bradyrhizobium sp. CB1650 |
Toxin (Protein)
Gene name | rlegT | Uniprot ID | - |
Locus tag | QA641_RS38045 | Protein ID | WP_279372498.1 |
Coordinates | 8036608..8037489 (-) | Length | 294 a.a. |
Antitoxin (Protein)
Gene name | rlegA | Uniprot ID | - |
Locus tag | QA641_RS38050 | Protein ID | WP_279372499.1 |
Coordinates | 8037482..8038126 (-) | Length | 215 a.a. |
Genomic Context
Location: 8035929..8036396 (468 bp)
Type: Others
Protein ID: WP_279372497.1
Type: Others
Protein ID: WP_279372497.1
Location: 8039195..8039746 (552 bp)
Type: Others
Protein ID: WP_279372501.1
Type: Others
Protein ID: WP_279372501.1
Location: 8032013..8034484 (2472 bp)
Type: Others
Protein ID: WP_279377920.1
Type: Others
Protein ID: WP_279377920.1
Location: 8034918..8035929 (1012 bp)
Type: Others
Protein ID: Protein_7555
Type: Others
Protein ID: Protein_7555
Location: 8036608..8037489 (882 bp)
Type: Toxin
Protein ID: WP_279372498.1
Type: Toxin
Protein ID: WP_279372498.1
Location: 8037482..8038126 (645 bp)
Type: Antitoxin
Protein ID: WP_279372499.1
Type: Antitoxin
Protein ID: WP_279372499.1
Location: 8038308..8038508 (201 bp)
Type: Others
Protein ID: WP_279372500.1
Type: Others
Protein ID: WP_279372500.1
Location: 8039751..8041505 (1755 bp)
Type: Others
Protein ID: WP_279372502.1
Type: Others
Protein ID: WP_279372502.1
Location: 8041564..8042676 (1113 bp)
Type: Others
Protein ID: WP_279372503.1
Type: Others
Protein ID: WP_279372503.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA641_RS38030 (QA641_38030) | 8032013..8034484 | - | 2472 | WP_279377920.1 | EAL domain-containing protein | - |
QA641_RS38035 (QA641_38035) | 8034918..8035929 | - | 1012 | Protein_7555 | IS5 family transposase | - |
QA641_RS38040 (QA641_38040) | 8035929..8036396 | + | 468 | WP_279372497.1 | hypothetical protein | - |
QA641_RS38045 (QA641_38045) | 8036608..8037489 | - | 882 | WP_279372498.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
QA641_RS38050 (QA641_38050) | 8037482..8038126 | - | 645 | WP_279372499.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | Antitoxin |
QA641_RS38055 (QA641_38055) | 8038308..8038508 | - | 201 | WP_279372500.1 | hypothetical protein | - |
QA641_RS38060 (QA641_38060) | 8039195..8039746 | + | 552 | WP_279372501.1 | hypothetical protein | - |
QA641_RS38065 (QA641_38065) | 8039751..8041505 | - | 1755 | WP_279372502.1 | phosphoenolpyruvate hydrolase family protein | - |
QA641_RS38070 (QA641_38070) | 8041564..8042676 | - | 1113 | WP_279372503.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 8034906..8035748 | 842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 294 a.a. Molecular weight: 32451.16 Da Isoelectric Point: 5.5615
>T276535 WP_279372498.1 NZ_CP121695:c8037489-8036608 [Bradyrhizobium sp. CB1650]
MANPTKNVAASVRARLLTLSKERNQPFDLLLTRYVLERLLYRLGSTDYRNRFVLKGAMLLATWVDNQFRPTRDLDLLGSG
DPDPEALLAIFKEIAAVDAADGVIFDPASFTVDRIRDENEYGGVRIKGNATVDNARVRVVIDIAFGDAIEPGVQETDLPV
LLDFPAPKLRSYPRETVIAEKFQAMVALGLANSRMKDFYDVWVLIRSYKFEGDTLARAIKATFARRKTEIPTVLPDAFTP
AFTEDNGKTDQWTAFTKQVAIDPGSLTDVANTLAEFLMPQAAKSRAMKGGATA
MANPTKNVAASVRARLLTLSKERNQPFDLLLTRYVLERLLYRLGSTDYRNRFVLKGAMLLATWVDNQFRPTRDLDLLGSG
DPDPEALLAIFKEIAAVDAADGVIFDPASFTVDRIRDENEYGGVRIKGNATVDNARVRVVIDIAFGDAIEPGVQETDLPV
LLDFPAPKLRSYPRETVIAEKFQAMVALGLANSRMKDFYDVWVLIRSYKFEGDTLARAIKATFARRKTEIPTVLPDAFTP
AFTEDNGKTDQWTAFTKQVAIDPGSLTDVANTLAEFLMPQAAKSRAMKGGATA
Download Length: 882 bp
Antitoxin
Download Length: 215 a.a. Molecular weight: 23466.17 Da Isoelectric Point: 10.7810
>AT276535 WP_279372499.1 NZ_CP121695:c8038126-8037482 [Bradyrhizobium sp. CB1650]
MAKPSSTQQDRATEFLKERGIARLSELATAGVTAATIARMKQKGLIVQLGRGLYQLSDAPIDTHHSLAEAAKRVPKGVVA
LTSALAFHDLTDTIPSMVWLAIGPKDRQPLSTNPPMQFVRFSPARLQEGVEIHTIEGCPVKIFSPAKTVVDLFRYRRSAG
TRYRHSTGLNLALEGLREALRTRKAKPSEIADFARKAGVWKAMQPYMDAMTANG
MAKPSSTQQDRATEFLKERGIARLSELATAGVTAATIARMKQKGLIVQLGRGLYQLSDAPIDTHHSLAEAAKRVPKGVVA
LTSALAFHDLTDTIPSMVWLAIGPKDRQPLSTNPPMQFVRFSPARLQEGVEIHTIEGCPVKIFSPAKTVVDLFRYRRSAG
TRYRHSTGLNLALEGLREALRTRKAKPSEIADFARKAGVWKAMQPYMDAMTANG
Download Length: 645 bp