Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 5278554..5279118 | Replicon | chromosome |
| Accession | NZ_CP121682 | ||
| Organism | Streptomyces sp. HUAS 5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PYS65_RS24070 | Protein ID | WP_279336020.1 |
| Coordinates | 5278792..5279118 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PYS65_RS24065 | Protein ID | WP_279336019.1 |
| Coordinates | 5278554..5278784 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYS65_RS24045 (PYS65_24045) | 5274204..5274491 | + | 288 | WP_279336015.1 | hypothetical protein | - |
| PYS65_RS24050 (PYS65_24050) | 5274716..5274940 | + | 225 | WP_279336016.1 | hypothetical protein | - |
| PYS65_RS24055 (PYS65_24055) | 5275229..5277823 | - | 2595 | WP_279336017.1 | aminopeptidase N | - |
| PYS65_RS24060 (PYS65_24060) | 5277936..5278430 | + | 495 | WP_279336018.1 | DUF1203 domain-containing protein | - |
| PYS65_RS24065 (PYS65_24065) | 5278554..5278784 | + | 231 | WP_279336019.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PYS65_RS24070 (PYS65_24070) | 5278792..5279118 | + | 327 | WP_279336020.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYS65_RS24075 (PYS65_24075) | 5279180..5280196 | - | 1017 | WP_279336021.1 | aspartate-semialdehyde dehydrogenase | - |
| PYS65_RS24080 (PYS65_24080) | 5280527..5281066 | + | 540 | WP_279336022.1 | sigma-70 family RNA polymerase sigma factor | - |
| PYS65_RS24085 (PYS65_24085) | 5281068..5281886 | + | 819 | WP_279336023.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11861.63 Da Isoelectric Point: 10.7240
>T276534 WP_279336020.1 NZ_CP121682:5278792-5279118 [Streptomyces sp. HUAS 5]
MVDLEPARGSEANKVRPAVIVSNNAANESVVQHNRGVVTVVPLTSNTSRVLTFQVFLSSDESRLPKDSKVQCEQVRAVAP
DRLLHKVGAVPRQRMAEIDVALRRHLAL
MVDLEPARGSEANKVRPAVIVSNNAANESVVQHNRGVVTVVPLTSNTSRVLTFQVFLSSDESRLPKDSKVQCEQVRAVAP
DRLLHKVGAVPRQRMAEIDVALRRHLAL
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|