Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 4876976..4877541 | Replicon | chromosome |
| Accession | NZ_CP121682 | ||
| Organism | Streptomyces sp. HUAS 5 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PYS65_RS22315 | Protein ID | WP_279335708.1 |
| Coordinates | 4877173..4877541 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A101UWX4 |
| Locus tag | PYS65_RS22310 | Protein ID | WP_060892904.1 |
| Coordinates | 4876976..4877173 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYS65_RS22275 (PYS65_22275) | 4873030..4873386 | - | 357 | WP_279335702.1 | MerR family transcriptional regulator | - |
| PYS65_RS22280 (PYS65_22280) | 4873476..4873937 | + | 462 | WP_279335703.1 | hypothetical protein | - |
| PYS65_RS22285 (PYS65_22285) | 4874001..4874330 | - | 330 | WP_279335704.1 | hypothetical protein | - |
| PYS65_RS22290 (PYS65_22290) | 4874327..4874635 | - | 309 | WP_279335705.1 | hypothetical protein | - |
| PYS65_RS22295 (PYS65_22295) | 4874782..4875012 | + | 231 | WP_279335706.1 | GntR family transcriptional regulator | - |
| PYS65_RS22305 (PYS65_22305) | 4875465..4876943 | + | 1479 | WP_279335707.1 | MFS transporter | - |
| PYS65_RS22310 (PYS65_22310) | 4876976..4877173 | + | 198 | WP_060892904.1 | hypothetical protein | Antitoxin |
| PYS65_RS22315 (PYS65_22315) | 4877173..4877541 | + | 369 | WP_279335708.1 | Fic family protein | Toxin |
| PYS65_RS22320 (PYS65_22320) | 4877675..4879465 | + | 1791 | WP_279335709.1 | DEAD/DEAH box helicase | - |
| PYS65_RS22325 (PYS65_22325) | 4879760..4880401 | + | 642 | WP_279335710.1 | helix-turn-helix domain-containing protein | - |
| PYS65_RS22330 (PYS65_22330) | 4880536..4881327 | + | 792 | WP_279335711.1 | S16 family serine protease | - |
| PYS65_RS22335 (PYS65_22335) | 4881341..4882309 | - | 969 | WP_279335712.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13709.60 Da Isoelectric Point: 5.1138
>T276533 WP_279335708.1 NZ_CP121682:4877173-4877541 [Streptomyces sp. HUAS 5]
MHYLTLPELLNLAKRLGEDAVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHALVDGNKRLAWYATWVFL
HMNGHALDPDFDVDEAERFVLDVCQGALDVPKIASQLPRFAR
MHYLTLPELLNLAKRLGEDAVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHALVDGNKRLAWYATWVFL
HMNGHALDPDFDVDEAERFVLDVCQGALDVPKIASQLPRFAR
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|