Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-higA/VapC-couple_hipB |
| Location | 4669212..4669888 | Replicon | chromosome |
| Accession | NZ_CP121682 | ||
| Organism | Streptomyces sp. HUAS 5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PYS65_RS21450 | Protein ID | WP_279335548.1 |
| Coordinates | 4669466..4669888 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PYS65_RS21445 | Protein ID | WP_279335547.1 |
| Coordinates | 4669212..4669445 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYS65_RS21425 (PYS65_21425) | 4665580..4665765 | - | 186 | WP_279335545.1 | antitoxin | - |
| PYS65_RS21430 (PYS65_21430) | 4666065..4666775 | + | 711 | WP_279338026.1 | HNH endonuclease family protein | - |
| PYS65_RS21435 (PYS65_21435) | 4666938..4667624 | + | 687 | WP_279335546.1 | hypothetical protein | - |
| PYS65_RS21440 (PYS65_21440) | 4667663..4669159 | + | 1497 | WP_279338027.1 | protein kinase | - |
| PYS65_RS21445 (PYS65_21445) | 4669212..4669445 | - | 234 | WP_279335547.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PYS65_RS21450 (PYS65_21450) | 4669466..4669888 | - | 423 | WP_279335548.1 | PIN domain nuclease | Toxin |
| PYS65_RS21455 (PYS65_21455) | 4669885..4670085 | - | 201 | WP_279335549.1 | hypothetical protein | - |
| PYS65_RS21460 (PYS65_21460) | 4670490..4671134 | + | 645 | WP_279335550.1 | SurA N-terminal domain-containing protein | - |
| PYS65_RS21465 (PYS65_21465) | 4671219..4672235 | + | 1017 | WP_279335551.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| PYS65_RS21470 (PYS65_21470) | 4672298..4673584 | + | 1287 | WP_279335552.1 | cytochrome P450 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15353.46 Da Isoelectric Point: 5.9868
>T276532 WP_279335548.1 NZ_CP121682:c4669888-4669466 [Streptomyces sp. HUAS 5]
VSKAFLIDTSACNRLFRLPGVEREWAQVLDAGRVSVCEVTELELVRAAGGREERALLDRYLHDAFGWTPAPERTLLRARQ
VQELLVTSGQHHGPGAVDLMVAATAELSGLVLLHYDADFEAIAKATGQPHRWIAPRGSVD
VSKAFLIDTSACNRLFRLPGVEREWAQVLDAGRVSVCEVTELELVRAAGGREERALLDRYLHDAFGWTPAPERTLLRARQ
VQELLVTSGQHHGPGAVDLMVAATAELSGLVLLHYDADFEAIAKATGQPHRWIAPRGSVD
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|