Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 416591..417228 | Replicon | chromosome |
Accession | NZ_CP121671 | ||
Organism | Halobacillus naozhouensis strain KCTC 13234 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | P9989_RS02295 | Protein ID | WP_079526733.1 |
Coordinates | 416878..417228 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | P9989_RS02290 | Protein ID | WP_079525632.1 |
Coordinates | 416591..416872 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9989_RS02270 (P9989_02265) | 412085..412459 | + | 375 | WP_283077228.1 | holo-ACP synthase | - |
P9989_RS02275 (P9989_02270) | 412499..414016 | + | 1518 | WP_283077229.1 | NAD(P)H-hydrate dehydratase | - |
P9989_RS02280 (P9989_02275) | 414071..415096 | + | 1026 | WP_283077230.1 | outer membrane lipoprotein carrier protein LolA | - |
P9989_RS02285 (P9989_02280) | 415268..416434 | + | 1167 | WP_283077231.1 | alanine racemase | - |
P9989_RS02290 (P9989_02285) | 416591..416872 | + | 282 | WP_079525632.1 | antitoxin | Antitoxin |
P9989_RS02295 (P9989_02290) | 416878..417228 | + | 351 | WP_079526733.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P9989_RS02300 (P9989_02295) | 417447..418316 | + | 870 | WP_283077232.1 | RsbT co-antagonist protein RsbRA | - |
P9989_RS02305 (P9989_02300) | 418322..418678 | + | 357 | WP_079525635.1 | STAS domain-containing protein | - |
P9989_RS02310 (P9989_02305) | 418681..419082 | + | 402 | WP_283077233.1 | anti-sigma regulatory factor | - |
P9989_RS02315 (P9989_02310) | 419096..420106 | + | 1011 | WP_283077234.1 | PP2C family protein-serine/threonine phosphatase | - |
P9989_RS02320 (P9989_02315) | 420171..420500 | + | 330 | WP_283077235.1 | STAS domain-containing protein | - |
P9989_RS02325 (P9989_02320) | 420503..420979 | + | 477 | WP_283077236.1 | anti-sigma B factor RsbW | - |
P9989_RS02330 (P9989_02325) | 420951..421730 | + | 780 | WP_283077237.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12897.92 Da Isoelectric Point: 5.6920
>T276525 WP_079526733.1 NZ_CP121671:416878-417228 [Halobacillus naozhouensis]
VIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAEKYGFERNSVILLEQI
RTIDKQRLTDKITHLDGPMMQQVNESLQISLGLIDF
VIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAEKYGFERNSVILLEQI
RTIDKQRLTDKITHLDGPMMQQVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|