Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 7703398..7704101 | Replicon | chromosome |
Accession | NZ_CP121668 | ||
Organism | Bradyrhizobium sp. CB2312 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA642_RS37390 | Protein ID | WP_283081374.1 |
Coordinates | 7703679..7704101 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA642_RS37385 | Protein ID | WP_283081373.1 |
Coordinates | 7703398..7703682 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA642_RS37365 (QA642_37365) | 7698470..7699444 | - | 975 | WP_283081369.1 | sugar ABC transporter permease | - |
QA642_RS37370 (QA642_37370) | 7699444..7700529 | - | 1086 | WP_283081370.1 | ABC transporter ATP-binding protein | - |
QA642_RS37375 (QA642_37375) | 7700542..7701618 | - | 1077 | WP_283081371.1 | ABC transporter ATP-binding protein | - |
QA642_RS37380 (QA642_37380) | 7701615..7703165 | - | 1551 | WP_283081372.1 | glycerol-3-phosphate dehydrogenase | - |
QA642_RS37385 (QA642_37385) | 7703398..7703682 | + | 285 | WP_283081373.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QA642_RS37390 (QA642_37390) | 7703679..7704101 | + | 423 | WP_283081374.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA642_RS37395 (QA642_37395) | 7704106..7704951 | - | 846 | WP_235539959.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QA642_RS37400 (QA642_37400) | 7705040..7705726 | - | 687 | WP_283081375.1 | HAD-IA family hydrolase | - |
QA642_RS37405 (QA642_37405) | 7705881..7706333 | + | 453 | WP_283081376.1 | nuclear transport factor 2 family protein | - |
QA642_RS37410 (QA642_37410) | 7706559..7706750 | - | 192 | WP_195799755.1 | hypothetical protein | - |
QA642_RS37415 (QA642_37415) | 7706941..7707351 | - | 411 | WP_283081377.1 | acyl-CoA thioesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15325.73 Da Isoelectric Point: 7.2069
>T276523 WP_283081374.1 NZ_CP121668:7703679-7704101 [Bradyrhizobium sp. CB2312]
VNLLLDTNVLSEVRRPAPSLKVLAWLDTIDEDRAFISVASIAELRRGIALLKDGRRRTALAAWLAHDLPARFAERVLPID
HAVADRWGDLMAESRRTGVALSVMDGFFAATALANSLTLVTRNVKDFAALGVPLLNPWDA
VNLLLDTNVLSEVRRPAPSLKVLAWLDTIDEDRAFISVASIAELRRGIALLKDGRRRTALAAWLAHDLPARFAERVLPID
HAVADRWGDLMAESRRTGVALSVMDGFFAATALANSLTLVTRNVKDFAALGVPLLNPWDA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|