Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 536731..537359 | Replicon | chromosome |
| Accession | NZ_CP121668 | ||
| Organism | Bradyrhizobium sp. CB2312 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA642_RS02570 | Protein ID | WP_283083246.1 |
| Coordinates | 536958..537359 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA642_RS02565 | Protein ID | WP_283083245.1 |
| Coordinates | 536731..536961 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA642_RS02550 (QA642_02550) | 533338..534033 | - | 696 | WP_283083243.1 | hypothetical protein | - |
| QA642_RS02555 (QA642_02555) | 534204..535232 | + | 1029 | WP_283083244.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QA642_RS02560 (QA642_02560) | 535384..536655 | + | 1272 | WP_283087137.1 | Spy/CpxP family protein refolding chaperone | - |
| QA642_RS02565 (QA642_02565) | 536731..536961 | + | 231 | WP_283083245.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QA642_RS02570 (QA642_02570) | 536958..537359 | + | 402 | WP_283083246.1 | PIN domain-containing protein | Toxin |
| QA642_RS02575 (QA642_02575) | 537441..538268 | - | 828 | WP_283083247.1 | hypothetical protein | - |
| QA642_RS02580 (QA642_02580) | 538534..540981 | - | 2448 | WP_283083248.1 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14607.53 Da Isoelectric Point: 6.2130
>T276521 WP_283083246.1 NZ_CP121668:536958-537359 [Bradyrhizobium sp. CB2312]
VSAFFDSNILIYAYSTDTRRQRALTTIAGGGIISAQVLNEFTNVLRKKQRQDWPVIEAAVQSLRFRFPDIVPLTSDTHTA
ALALARDHTLAFYDALIVAAAIEAGCDTLYSEDLQHSRSFSGLTIVNPFLGST
VSAFFDSNILIYAYSTDTRRQRALTTIAGGGIISAQVLNEFTNVLRKKQRQDWPVIEAAVQSLRFRFPDIVPLTSDTHTA
ALALARDHTLAFYDALIVAAAIEAGCDTLYSEDLQHSRSFSGLTIVNPFLGST
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|