Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 7061806..7062518 | Replicon | chromosome |
Accession | NZ_CP121667 | ||
Organism | Bradyrhizobium pachyrhizi strain CB1923 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A844T9Y2 |
Locus tag | QA639_RS33525 | Protein ID | WP_028337910.1 |
Coordinates | 7062081..7062518 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA639_RS33520 | Protein ID | WP_283088169.1 |
Coordinates | 7061806..7062084 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA639_RS33495 (QA639_33495) | 7058168..7059190 | - | 1023 | WP_283090655.1 | IS3 family transposase | - |
QA639_RS33500 (QA639_33500) | 7059118..7059270 | - | 153 | Protein_6647 | transposase | - |
QA639_RS33505 (QA639_33505) | 7059497..7060098 | - | 602 | Protein_6648 | IS21-like element helper ATPase IstB | - |
QA639_RS33510 (QA639_33510) | 7060230..7061245 | - | 1016 | Protein_6649 | IS110 family transposase | - |
QA639_RS33515 (QA639_33515) | 7061398..7061688 | + | 291 | WP_157348971.1 | hypothetical protein | - |
QA639_RS33520 (QA639_33520) | 7061806..7062084 | + | 279 | WP_283088169.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QA639_RS33525 (QA639_33525) | 7062081..7062518 | + | 438 | WP_028337910.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA639_RS33530 (QA639_33530) | 7062515..7063411 | + | 897 | WP_283088170.1 | hypothetical protein | - |
QA639_RS33535 (QA639_33535) | 7063554..7063847 | - | 294 | Protein_6654 | transposase | - |
QA639_RS33540 (QA639_33540) | 7063910..7064083 | + | 174 | WP_244486498.1 | hypothetical protein | - |
QA639_RS33545 (QA639_33545) | 7064415..7064631 | + | 217 | Protein_6656 | hypothetical protein | - |
QA639_RS33550 (QA639_33550) | 7064840..7066432 | - | 1593 | WP_283090656.1 | ATP-binding protein | - |
QA639_RS33555 (QA639_33555) | 7066917..7067159 | - | 243 | WP_283088171.1 | multicopper oxidase domain-containing protein | - |
QA639_RS33560 (QA639_33560) | 7067180..7067278 | - | 99 | WP_283088172.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 7055353..7063718 | 8365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15817.13 Da Isoelectric Point: 4.4902
>T276520 WP_028337910.1 NZ_CP121667:7062081-7062518 [Bradyrhizobium pachyrhizi]
MNVLLDTNVLSEVRRPAPDPKVLAWLDTIDEDRAFISVASIAELRRGIALMDDGRRREALSAWLAEDLPARFAGRILSID
PAIAGRWGDLMAQARQSGFALSVMDGFFAATALDRELVLATRNTKDFAPLGVPLLNPWTDEGALG
MNVLLDTNVLSEVRRPAPDPKVLAWLDTIDEDRAFISVASIAELRRGIALMDDGRRREALSAWLAEDLPARFAGRILSID
PAIAGRWGDLMAQARQSGFALSVMDGFFAATALDRELVLATRNTKDFAPLGVPLLNPWTDEGALG
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|