Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 748244..748890 | Replicon | chromosome |
| Accession | NZ_CP121666 | ||
| Organism | Bradyrhizobium sp. CB1717 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA649_RS03435 | Protein ID | WP_283022970.1 |
| Coordinates | 748244..748657 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA649_RS03440 | Protein ID | WP_283022971.1 |
| Coordinates | 748654..748890 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA649_RS03415 (QA649_03415) | 744459..745550 | + | 1092 | WP_283022967.1 | branched-chain amino acid ABC transporter permease | - |
| QA649_RS03420 (QA649_03420) | 745540..746271 | + | 732 | WP_283022968.1 | ABC transporter ATP-binding protein | - |
| QA649_RS03425 (QA649_03425) | 746264..746962 | + | 699 | WP_283022969.1 | ABC transporter ATP-binding protein | - |
| QA649_RS03430 (QA649_03430) | 747184..748116 | + | 933 | WP_283026035.1 | transposase | - |
| QA649_RS03435 (QA649_03435) | 748244..748657 | - | 414 | WP_283022970.1 | PIN domain-containing protein | Toxin |
| QA649_RS03440 (QA649_03440) | 748654..748890 | - | 237 | WP_283022971.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QA649_RS03445 (QA649_03445) | 749017..749865 | - | 849 | WP_283022972.1 | DUF3883 domain-containing protein | - |
| QA649_RS03450 (QA649_03450) | 749972..751474 | - | 1503 | WP_283022973.1 | murein L,D-transpeptidase family protein | - |
| QA649_RS03455 (QA649_03455) | 751975..752937 | - | 963 | WP_283022974.1 | acetyl-CoA carboxylase carboxyltransferase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14623.53 Da Isoelectric Point: 4.1747
>T276519 WP_283022970.1 NZ_CP121666:c748657-748244 [Bradyrhizobium sp. CB1717]
VTAFLDTNILVYAQQRGTKAKISQDLIDEGGTISVQVLNELANVLSKKQGRSWRDIELVFDDIDNALDPVLPLTATTSRA
ALALARDDGFAFYDALIVAAAIEAGCDILYSEDMQHGRSIGGLTIVNPFLGSASPSP
VTAFLDTNILVYAQQRGTKAKISQDLIDEGGTISVQVLNELANVLSKKQGRSWRDIELVFDDIDNALDPVLPLTATTSRA
ALALARDDGFAFYDALIVAAAIEAGCDILYSEDMQHGRSIGGLTIVNPFLGSASPSP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|