Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1316314..1316897 | Replicon | plasmid pCB3090_1 |
| Accession | NZ_CP121663 | ||
| Organism | Rhizobium sp. CB3090 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA646_RS24810 | Protein ID | WP_283059391.1 |
| Coordinates | 1316511..1316897 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0T6ZM79 |
| Locus tag | QA646_RS24805 | Protein ID | WP_017958375.1 |
| Coordinates | 1316314..1316514 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA646_RS24795 (QA646_24795) | 1312318..1313850 | - | 1533 | WP_283059389.1 | FAD-dependent monooxygenase | - |
| QA646_RS24800 (QA646_24800) | 1315372..1316010 | + | 639 | WP_283059390.1 | GGDEF domain-containing protein | - |
| QA646_RS24805 (QA646_24805) | 1316314..1316514 | + | 201 | WP_017958375.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QA646_RS24810 (QA646_24810) | 1316511..1316897 | + | 387 | WP_283059391.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA646_RS24815 (QA646_24815) | 1317014..1317258 | - | 245 | Protein_1195 | myo-inosose-2 dehydratase | - |
| QA646_RS24820 (QA646_24820) | 1317861..1318772 | + | 912 | WP_283059392.1 | hypothetical protein | - |
| QA646_RS24825 (QA646_24825) | 1319721..1320617 | - | 897 | WP_283059393.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | katA | 1..1773801 | 1773801 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14179.37 Da Isoelectric Point: 7.4769
>T276518 WP_283059391.1 NZ_CP121663:1316511-1316897 [Rhizobium sp. CB3090]
VILADTSIWIDHFRQADAELRTIIENDRLLCHPAVVGELALGSLRDRGRVITFLAAQRQAFVATHDEVMIMIDRHGIFSM
GIGYTDAHLLASILLDPRAALWTRDKRLQAAAEKAGASLHTPVKARNT
VILADTSIWIDHFRQADAELRTIIENDRLLCHPAVVGELALGSLRDRGRVITFLAAQRQAFVATHDEVMIMIDRHGIFSM
GIGYTDAHLLASILLDPRAALWTRDKRLQAAAEKAGASLHTPVKARNT
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|