Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3691143..3691708 | Replicon | chromosome |
Accession | NZ_CP121662 | ||
Organism | Rhizobium sp. CB3090 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QA646_RS17705 | Protein ID | WP_283056678.1 |
Coordinates | 3691415..3691708 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QA646_RS17700 | Protein ID | WP_283056677.1 |
Coordinates | 3691143..3691427 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA646_RS17680 (QA646_17680) | 3686598..3688235 | + | 1638 | WP_283056673.1 | ABC transporter ATP-binding protein | - |
QA646_RS17685 (QA646_17685) | 3688247..3689206 | + | 960 | WP_283056674.1 | glyoxylate/hydroxypyruvate reductase A | - |
QA646_RS17690 (QA646_17690) | 3689284..3689559 | + | 276 | WP_283056675.1 | hypothetical protein | - |
QA646_RS17695 (QA646_17695) | 3689750..3691054 | + | 1305 | WP_283056676.1 | nicotinate phosphoribosyltransferase | - |
QA646_RS17700 (QA646_17700) | 3691143..3691427 | + | 285 | WP_283056677.1 | CopG family transcriptional regulator | Antitoxin |
QA646_RS17705 (QA646_17705) | 3691415..3691708 | + | 294 | WP_283056678.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA646_RS17710 (QA646_17710) | 3691716..3692273 | - | 558 | WP_283056679.1 | hypothetical protein | - |
QA646_RS17715 (QA646_17715) | 3692248..3692406 | - | 159 | WP_283056680.1 | hypothetical protein | - |
QA646_RS17720 (QA646_17720) | 3692433..3692699 | - | 267 | WP_283056681.1 | hypothetical protein | - |
QA646_RS17725 (QA646_17725) | 3692993..3695005 | + | 2013 | WP_283056682.1 | mechanosensitive ion channel family protein | - |
QA646_RS17730 (QA646_17730) | 3695015..3695743 | - | 729 | WP_283056683.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11201.06 Da Isoelectric Point: 11.2113
>T276517 WP_283056678.1 NZ_CP121662:3691415-3691708 [Rhizobium sp. CB3090]
MPSVRLTQRALRDLERMRTFLRPKNAAAAKKASTKIIQTIRMLSNQPDMGRPVENSQQGLRELIVRFGRDGYVVLYRYIG
EEILIAAIRHGREDGYK
MPSVRLTQRALRDLERMRTFLRPKNAAAAKKASTKIIQTIRMLSNQPDMGRPVENSQQGLRELIVRFGRDGYVVLYRYIG
EEILIAAIRHGREDGYK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|