Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 3095478..3096012 | Replicon | chromosome |
| Accession | NZ_CP121662 | ||
| Organism | Rhizobium sp. CB3090 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QA646_RS14890 | Protein ID | WP_283056189.1 |
| Coordinates | 3095478..3095780 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QA646_RS14895 | Protein ID | WP_283056190.1 |
| Coordinates | 3095770..3096012 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA646_RS14870 (QA646_14870) | 3090599..3092662 | - | 2064 | WP_283056185.1 | M3 family metallopeptidase | - |
| QA646_RS14875 (QA646_14875) | 3092759..3093400 | - | 642 | WP_283056186.1 | LysE family translocator | - |
| QA646_RS14880 (QA646_14880) | 3093561..3094043 | + | 483 | WP_283056187.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QA646_RS14885 (QA646_14885) | 3094131..3095354 | - | 1224 | WP_283056188.1 | argininosuccinate synthase | - |
| QA646_RS14890 (QA646_14890) | 3095478..3095780 | - | 303 | WP_283056189.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QA646_RS14895 (QA646_14895) | 3095770..3096012 | - | 243 | WP_283056190.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| QA646_RS14900 (QA646_14900) | 3096100..3096954 | + | 855 | WP_283056191.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| QA646_RS14905 (QA646_14905) | 3097020..3097661 | + | 642 | WP_283056192.1 | LysE family translocator | - |
| QA646_RS14910 (QA646_14910) | 3097645..3098073 | - | 429 | WP_283056193.1 | hypothetical protein | - |
| QA646_RS14915 (QA646_14915) | 3098079..3099314 | - | 1236 | WP_283056194.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QA646_RS14920 (QA646_14920) | 3099577..3100137 | - | 561 | WP_283056195.1 | invasion associated locus B family protein | - |
| QA646_RS14925 (QA646_14925) | 3100467..3100856 | - | 390 | WP_283056196.1 | YkvA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11492.35 Da Isoelectric Point: 10.3134
>T276515 WP_283056189.1 NZ_CP121662:c3095780-3095478 [Rhizobium sp. CB3090]
MPAKRRSYKLLPKARQDLDAIWRYTFETWSFQQANAYYNELIARFPELAAGAVRGRRINGVKPGYLALACGSHFIVYKDD
VEAVAIIRILHQRMNIGAHL
MPAKRRSYKLLPKARQDLDAIWRYTFETWSFQQANAYYNELIARFPELAAGAVRGRRINGVKPGYLALACGSHFIVYKDD
VEAVAIIRILHQRMNIGAHL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|