Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 2449071..2449735 | Replicon | chromosome |
| Accession | NZ_CP121662 | ||
| Organism | Rhizobium sp. CB3090 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA646_RS11895 | Protein ID | WP_283055660.1 |
| Coordinates | 2449325..2449735 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA646_RS11890 | Protein ID | WP_283055659.1 |
| Coordinates | 2449071..2449325 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA646_RS11860 (QA646_11860) | 2444621..2445202 | + | 582 | WP_283055654.1 | NAD(P)H-dependent oxidoreductase | - |
| QA646_RS11865 (QA646_11865) | 2445248..2445637 | - | 390 | WP_283058854.1 | RidA family protein | - |
| QA646_RS11870 (QA646_11870) | 2445699..2446595 | - | 897 | WP_283055655.1 | DMT family transporter | - |
| QA646_RS11875 (QA646_11875) | 2446806..2447243 | + | 438 | WP_283055656.1 | hypothetical protein | - |
| QA646_RS11880 (QA646_11880) | 2447275..2447892 | - | 618 | WP_283055657.1 | alpha/beta hydrolase | - |
| QA646_RS11885 (QA646_11885) | 2447907..2448839 | - | 933 | WP_283055658.1 | VOC family protein | - |
| QA646_RS11890 (QA646_11890) | 2449071..2449325 | + | 255 | WP_283055659.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QA646_RS11895 (QA646_11895) | 2449325..2449735 | + | 411 | WP_283055660.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA646_RS11900 (QA646_11900) | 2449729..2450430 | - | 702 | WP_283055661.1 | uracil-DNA glycosylase | - |
| QA646_RS11905 (QA646_11905) | 2450606..2451289 | - | 684 | WP_283055662.1 | septation protein IspZ | - |
| QA646_RS11910 (QA646_11910) | 2451300..2453747 | - | 2448 | WP_283055663.1 | FAD-dependent oxidoreductase | - |
| QA646_RS11915 (QA646_11915) | 2453757..2454635 | - | 879 | WP_283055664.1 | choline kinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15141.27 Da Isoelectric Point: 6.8816
>T276514 WP_283055660.1 NZ_CP121662:2449325-2449735 [Rhizobium sp. CB3090]
MYLIDTNVISEARRGTPEAISWLRTADPSTVYLSVITLGEVMRGIALKRKSDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRVAALRPRGGADELIAATAIVHDLIVVTRNISNFDDTGVSVINPWDQTSY
MYLIDTNVISEARRGTPEAISWLRTADPSTVYLSVITLGEVMRGIALKRKSDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRVAALRPRGGADELIAATAIVHDLIVVTRNISNFDDTGVSVINPWDQTSY
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|