Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1577183..1577847 | Replicon | chromosome |
| Accession | NZ_CP121662 | ||
| Organism | Rhizobium sp. CB3090 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA646_RS07705 | Protein ID | WP_283058459.1 |
| Coordinates | 1577407..1577847 (+) | Length | 147 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA646_RS07700 | Protein ID | WP_283058458.1 |
| Coordinates | 1577183..1577410 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA646_RS07675 (QA646_07675) | 1572595..1573422 | - | 828 | WP_283058453.1 | inositol monophosphatase | - |
| QA646_RS07680 (QA646_07680) | 1573508..1574269 | - | 762 | WP_283058454.1 | Fic family protein | - |
| QA646_RS07685 (QA646_07685) | 1574343..1575218 | - | 876 | WP_283058455.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QA646_RS07690 (QA646_07690) | 1575279..1576208 | - | 930 | WP_283058456.1 | glutaminase | - |
| QA646_RS07695 (QA646_07695) | 1576280..1576897 | - | 618 | WP_283058457.1 | 30S ribosomal protein S4 | - |
| QA646_RS07700 (QA646_07700) | 1577183..1577410 | + | 228 | WP_283058458.1 | CopG family transcriptional regulator | Antitoxin |
| QA646_RS07705 (QA646_07705) | 1577407..1577847 | + | 441 | WP_283058459.1 | VapC toxin family PIN domain ribonuclease | Toxin |
| QA646_RS07710 (QA646_07710) | 1577854..1579371 | - | 1518 | WP_283058460.1 | ATP-binding protein | - |
| QA646_RS07715 (QA646_07715) | 1579500..1580645 | - | 1146 | WP_283058462.1 | alpha-hydroxy acid oxidase | - |
| QA646_RS07720 (QA646_07720) | 1580734..1581198 | - | 465 | WP_283058463.1 | GNAT family N-acetyltransferase | - |
| QA646_RS07725 (QA646_07725) | 1581201..1582001 | - | 801 | WP_283058464.1 | glutamate racemase | - |
| QA646_RS07730 (QA646_07730) | 1581982..1582824 | - | 843 | WP_283058466.1 | RNA methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 15809.01 Da Isoelectric Point: 6.6384
>T276513 WP_283058459.1 NZ_CP121662:1577407-1577847 [Rhizobium sp. CB3090]
VTFLLDVNVLIALFDPAHVSHDIAHNWFSSTGNQSWATCPLTENGVIRILGQSSYPNSPGPPSTVVPLIEELRRLPGHEF
WADDISLTDASLIDPARLLTPGQVTDSYLLALAKFRRGKLATLDRRLSTAAVKDGRAALHIIGSAT
VTFLLDVNVLIALFDPAHVSHDIAHNWFSSTGNQSWATCPLTENGVIRILGQSSYPNSPGPPSTVVPLIEELRRLPGHEF
WADDISLTDASLIDPARLLTPGQVTDSYLLALAKFRRGKLATLDRRLSTAAVKDGRAALHIIGSAT
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|