Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 420822..421456 | Replicon | chromosome |
| Accession | NZ_CP121662 | ||
| Organism | Rhizobium sp. CB3090 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA646_RS02045 | Protein ID | WP_283057298.1 |
| Coordinates | 421052..421456 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA646_RS02040 | Protein ID | WP_283057297.1 |
| Coordinates | 420822..421052 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA646_RS02010 (QA646_02010) | 415939..416955 | - | 1017 | WP_283057291.1 | polyprenyl synthetase family protein | - |
| QA646_RS02015 (QA646_02015) | 417064..417294 | + | 231 | WP_283057292.1 | DUF2007 domain-containing protein | - |
| QA646_RS02020 (QA646_02020) | 417303..418079 | + | 777 | WP_283057293.1 | methyltransferase | - |
| QA646_RS02025 (QA646_02025) | 418129..419475 | - | 1347 | WP_283057294.1 | Nramp family divalent metal transporter | - |
| QA646_RS02030 (QA646_02030) | 419690..420550 | + | 861 | WP_283057295.1 | S49 family peptidase | - |
| QA646_RS02035 (QA646_02035) | 420567..420758 | + | 192 | WP_283057296.1 | hypothetical protein | - |
| QA646_RS02040 (QA646_02040) | 420822..421052 | + | 231 | WP_283057297.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QA646_RS02045 (QA646_02045) | 421052..421456 | + | 405 | WP_283057298.1 | PIN domain-containing protein | Toxin |
| QA646_RS02050 (QA646_02050) | 421670..422629 | + | 960 | WP_283057299.1 | glycine--tRNA ligase subunit alpha | - |
| QA646_RS02055 (QA646_02055) | 422738..423289 | + | 552 | WP_283057300.1 | LemA family protein | - |
| QA646_RS02060 (QA646_02060) | 423377..424633 | + | 1257 | WP_283057301.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15247.54 Da Isoelectric Point: 5.6436
>T276512 WP_283057298.1 NZ_CP121662:421052-421456 [Rhizobium sp. CB3090]
MRALPPFLDTNVLLYAFTDDQRAQKAQLLLAEPFTISVQALNEFANVARKKLHLPWKRIHEAIRTIVELSTSVVAIDEKT
TLSALNLAERYNFSFYDAAMVAAALQANCERYYSEDLHDCLIVETRLTIINPFS
MRALPPFLDTNVLLYAFTDDQRAQKAQLLLAEPFTISVQALNEFANVARKKLHLPWKRIHEAIRTIVELSTSVVAIDEKT
TLSALNLAERYNFSFYDAAMVAAALQANCERYYSEDLHDCLIVETRLTIINPFS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|