Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1543776..1544437 | Replicon | plasmid pCB3126_1 |
Accession | NZ_CP121660 | ||
Organism | Sinorhizobium terangae strain CB3126 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA637_RS25830 | Protein ID | WP_283065574.1 |
Coordinates | 1544033..1544437 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA637_RS25825 | Protein ID | WP_283065572.1 |
Coordinates | 1543776..1544036 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA637_RS25785 (QA637_25785) | 1539430..1539566 | + | 137 | Protein_1415 | DNA helicase | - |
QA637_RS25790 (QA637_25790) | 1539626..1540108 | - | 483 | WP_283067352.1 | N-acetyltransferase | - |
QA637_RS25795 (QA637_25795) | 1540226..1541020 | - | 795 | WP_283065566.1 | class I SAM-dependent methyltransferase | - |
QA637_RS25800 (QA637_25800) | 1541119..1541283 | + | 165 | WP_283065567.1 | hypothetical protein | - |
QA637_RS25805 (QA637_25805) | 1541751..1541882 | + | 132 | Protein_1419 | IS3 family transposase | - |
QA637_RS25810 (QA637_25810) | 1541840..1541977 | + | 138 | WP_283067392.1 | hypothetical protein | - |
QA637_RS25815 (QA637_25815) | 1542048..1542383 | - | 336 | WP_283065568.1 | hypothetical protein | - |
QA637_RS25820 (QA637_25820) | 1542451..1542774 | - | 324 | WP_283065570.1 | DUF736 family protein | - |
QA637_RS25825 (QA637_25825) | 1543776..1544036 | + | 261 | WP_283065572.1 | antitoxin | Antitoxin |
QA637_RS25830 (QA637_25830) | 1544033..1544437 | + | 405 | WP_283065574.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA637_RS25835 (QA637_25835) | 1545082..1546023 | - | 942 | WP_283065576.1 | DUF2493 domain-containing protein | - |
QA637_RS25840 (QA637_25840) | 1546407..1547444 | - | 1038 | WP_283065578.1 | toprim domain-containing protein | - |
QA637_RS25845 (QA637_25845) | 1547460..1547786 | - | 327 | WP_283065580.1 | hypothetical protein | - |
QA637_RS25850 (QA637_25850) | 1547972..1548237 | + | 266 | Protein_1428 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB / katA | 1..2093508 | 2093508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14403.47 Da Isoelectric Point: 5.6844
>T276510 WP_283065574.1 NZ_CP121660:1544033-1544437 [Sinorhizobium terangae]
VISHLLDTNAVIALIGRKSDTLVSRVLDSPQGSIGLPSVVAYELYFGAQRSAKVQHNLETLRLLMADFPILDFDQNDAFV
AGAIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNGGEFNRVENLRVEDWSL
VISHLLDTNAVIALIGRKSDTLVSRVLDSPQGSIGLPSVVAYELYFGAQRSAKVQHNLETLRLLMADFPILDFDQNDAFV
AGAIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNGGEFNRVENLRVEDWSL
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|