Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 632318..632898 Replicon plasmid pCB3126_1
Accession NZ_CP121660
Organism Sinorhizobium terangae strain CB3126

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QA637_RS21655 Protein ID WP_283066828.1
Coordinates 632318..632701 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QA637_RS21660 Protein ID WP_283066829.1
Coordinates 632698..632898 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA637_RS21625 (QA637_21625) 627396..627548 - 153 WP_283067400.1 hypothetical protein -
QA637_RS21630 (QA637_21630) 627528..627956 + 429 WP_283067297.1 PAS domain-containing protein -
QA637_RS21635 (QA637_21635) 627883..628653 + 771 WP_283066826.1 ATP-binding protein -
QA637_RS21640 (QA637_21640) 628891..629124 + 234 Protein_586 integrase core domain-containing protein -
QA637_RS21645 (QA637_21645) 629146..629491 - 346 Protein_587 response regulator -
QA637_RS21650 (QA637_21650) 629618..631520 + 1903 Protein_588 potassium transporter Kup -
QA637_RS21655 (QA637_21655) 632318..632701 - 384 WP_283066828.1 type II toxin-antitoxin system VapC family toxin Toxin
QA637_RS21660 (QA637_21660) 632698..632898 - 201 WP_283066829.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QA637_RS21665 (QA637_21665) 633767..634021 + 255 WP_283066831.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QA637_RS21670 (QA637_21670) 634021..634428 + 408 WP_283066833.1 type II toxin-antitoxin system VapC family toxin -
QA637_RS21675 (QA637_21675) 634583..634699 + 117 Protein_593 GntR family transcriptional regulator -
QA637_RS21680 (QA637_21680) 634949..636274 + 1326 WP_167528425.1 ABC transporter substrate-binding protein -
QA637_RS21685 (QA637_21685) 636356..637324 + 969 WP_283066836.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - htpB / katA 1..2093508 2093508


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14080.28 Da        Isoelectric Point: 6.9172

>T276509 WP_283066828.1 NZ_CP121660:c632701-632318 [Sinorhizobium terangae]
VILADTSIWIDHFRHTDPELRKIIEEDRLLCHPAVIGELALGSLRDRTSVIAFLTAQREALVATHDEVVMMIDRHAIFSM
GIGYTDAHLLASVLLDQRVVLWTRAKRLRAAAEKAGASLHTPAHAGN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7090.19 Da        Isoelectric Point: 11.1107

>AT276509 WP_283066829.1 NZ_CP121660:c632898-632698 [Sinorhizobium terangae]
MRSTINLDDTLVERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSPAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References