Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 173924..174564 | Replicon | plasmid pCB3126_1 |
Accession | NZ_CP121660 | ||
Organism | Sinorhizobium terangae strain CB3126 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA637_RS19530 | Protein ID | WP_153441708.1 |
Coordinates | 173924..174310 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA637_RS19535 | Protein ID | WP_153441709.1 |
Coordinates | 174310..174564 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA637_RS19500 (QA637_19500) | 169383..169994 | + | 612 | WP_184108609.1 | hypothetical protein | - |
QA637_RS19505 (QA637_19505) | 170027..170284 | - | 258 | WP_283066350.1 | DUF1127 domain-containing protein | - |
QA637_RS19510 (QA637_19510) | 170387..171904 | + | 1518 | WP_184108608.1 | winged helix-turn-helix domain-containing tetratricopeptide repeat protein | - |
QA637_RS19515 (QA637_19515) | 172102..172497 | - | 396 | WP_283066352.1 | GFA family protein | - |
QA637_RS19520 (QA637_19520) | 172606..173073 | - | 468 | WP_283066354.1 | VOC family protein | - |
QA637_RS19525 (QA637_19525) | 173467..173757 | + | 291 | WP_153441707.1 | DUF2934 domain-containing protein | - |
QA637_RS19530 (QA637_19530) | 173924..174310 | - | 387 | WP_153441708.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA637_RS19535 (QA637_19535) | 174310..174564 | - | 255 | WP_153441709.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QA637_RS19540 (QA637_19540) | 174887..175567 | - | 681 | WP_153441710.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
QA637_RS19545 (QA637_19545) | 175589..176755 | - | 1167 | WP_283066357.1 | cystathionine gamma-synthase | - |
QA637_RS19550 (QA637_19550) | 176803..177438 | - | 636 | WP_283066359.1 | peroxiredoxin | - |
QA637_RS19555 (QA637_19555) | 177600..178451 | + | 852 | WP_153441713.1 | LysR family transcriptional regulator | - |
QA637_RS19560 (QA637_19560) | 178483..178779 | - | 297 | WP_283066360.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB / katA | 1..2093508 | 2093508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14018.93 Da Isoelectric Point: 4.6381
>T276507 WP_153441708.1 NZ_CP121660:c174310-173924 [Sinorhizobium terangae]
MVIDTSAIVAVAFNEPEAETYERKVIDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDIEAA
MVIDTSAIVAVAFNEPEAETYERKVIDAPRRFISAATVLELAIVIEARLGEAGAAELDLWLYKAGVEIVAVDAEQIAVAR
RAWRSYGKGRHPAGLNYGDCFSYALAKTRNEPLLFKGDDFSRTDIEAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|