Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 113868..114466 | Replicon | plasmid pCB3126_1 |
Accession | NZ_CP121660 | ||
Organism | Sinorhizobium terangae strain CB3126 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QA637_RS19255 | Protein ID | WP_153441353.1 |
Coordinates | 114173..114466 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q930F1 |
Locus tag | QA637_RS19250 | Protein ID | WP_010967242.1 |
Coordinates | 113868..114176 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA637_RS19230 (QA637_19230) | 110900..111934 | + | 1035 | WP_283066277.1 | ABC transporter substrate-binding protein | - |
QA637_RS19235 (QA637_19235) | 112226..112453 | + | 228 | Protein_106 | hypothetical protein | - |
QA637_RS19240 (QA637_19240) | 112607..112927 | + | 321 | WP_283066278.1 | hypothetical protein | - |
QA637_RS19245 (QA637_19245) | 113219..113446 | + | 228 | Protein_108 | hypothetical protein | - |
QA637_RS19250 (QA637_19250) | 113868..114176 | + | 309 | WP_010967242.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QA637_RS19255 (QA637_19255) | 114173..114466 | + | 294 | WP_153441353.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA637_RS19260 (QA637_19260) | 114821..115276 | - | 456 | WP_153441354.1 | DUF4440 domain-containing protein | - |
QA637_RS19265 (QA637_19265) | 115815..116852 | + | 1038 | WP_283066298.1 | IS110 family transposase | - |
QA637_RS19270 (QA637_19270) | 117399..119033 | - | 1635 | WP_283066299.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB / katA | 1..2093508 | 2093508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T276506 WP_153441353.1 NZ_CP121660:114173-114466 [Sinorhizobium terangae]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRVAGTRELVIPRTPYIAAYMVMADRIRI
LRVLHGAQKWPSELDDE
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRVAGTRELVIPRTPYIAAYMVMADRIRI
LRVLHGAQKWPSELDDE
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|