Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 10005..10648 | Replicon | plasmid pCB3171_4 |
Accession | NZ_CP121656 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA648_RS35520 | Protein ID | WP_283055014.1 |
Coordinates | 10005..10391 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA648_RS35525 | Protein ID | WP_283055015.1 |
Coordinates | 10391..10648 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS35495 (QA648_35495) | 5096..6193 | + | 1098 | WP_283055071.1 | IS1595 family transposase | - |
QA648_RS35500 (QA648_35500) | 6458..7279 | - | 822 | WP_283055010.1 | hypothetical protein | - |
QA648_RS35505 (QA648_35505) | 7808..8266 | + | 459 | WP_283055011.1 | GNAT family N-acetyltransferase | - |
QA648_RS35510 (QA648_35510) | 8558..8794 | + | 237 | WP_283055012.1 | hypothetical protein | - |
QA648_RS35515 (QA648_35515) | 8953..10005 | - | 1053 | WP_283055013.1 | site-specific integrase | - |
QA648_RS35520 (QA648_35520) | 10005..10391 | - | 387 | WP_283055014.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA648_RS35525 (QA648_35525) | 10391..10648 | - | 258 | WP_283055015.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QA648_RS35530 (QA648_35530) | 10909..12480 | + | 1572 | WP_283055072.1 | Mu transposase C-terminal domain-containing protein | - |
QA648_RS35535 (QA648_35535) | 12471..13409 | + | 939 | WP_283055016.1 | TniB family NTP-binding protein | - |
QA648_RS35540 (QA648_35540) | 13406..14548 | + | 1143 | WP_283055017.1 | TniQ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..186301 | 186301 | |
- | flank | IS/Tn | - | - | 5096..6193 | 1097 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14094.36 Da Isoelectric Point: 4.4937
>T276504 WP_283055014.1 NZ_CP121656:c10391-10005 [Rhizobium sp. CB3171]
MVIDTSAIVAMLRNEPEMERLEKALVADPIRLVPATCVLEARMVLVSRRGEHALAEIDLWLSKIKAEIIPVDADLVDLAT
QAWLTYGKGRHPAGLNFADCFSYALAKRADEALLFIGQDFAQTDIEAA
MVIDTSAIVAMLRNEPEMERLEKALVADPIRLVPATCVLEARMVLVSRRGEHALAEIDLWLSKIKAEIIPVDADLVDLAT
QAWLTYGKGRHPAGLNFADCFSYALAKRADEALLFIGQDFAQTDIEAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|