Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 107225..107823 | Replicon | plasmid pCB3171_3 |
Accession | NZ_CP121655 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QA648_RS34975 | Protein ID | WP_104825436.1 |
Coordinates | 107530..107823 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QA648_RS34970 | Protein ID | WP_283054768.1 |
Coordinates | 107225..107533 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS34945 (QA648_34945) | 102844..103041 | + | 198 | WP_283054924.1 | hypothetical protein | - |
QA648_RS34950 (QA648_34950) | 103290..105308 | + | 2019 | WP_283054925.1 | hypothetical protein | - |
QA648_RS34955 (QA648_34955) | 105433..105669 | + | 237 | WP_283054926.1 | hypothetical protein | - |
QA648_RS34960 (QA648_34960) | 105650..106636 | + | 987 | WP_283054927.1 | Fic family protein | - |
QA648_RS34965 (QA648_34965) | 106767..106997 | - | 231 | WP_283054767.1 | hypothetical protein | - |
QA648_RS34970 (QA648_34970) | 107225..107533 | + | 309 | WP_283054768.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QA648_RS34975 (QA648_34975) | 107530..107823 | + | 294 | WP_104825436.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA648_RS34980 (QA648_34980) | 107881..110235 | - | 2355 | WP_283054769.1 | type IV secretory system conjugative DNA transfer family protein | - |
QA648_RS34985 (QA648_34985) | 110213..111259 | - | 1047 | WP_283054770.1 | P-type DNA transfer ATPase VirB11 | - |
QA648_RS34990 (QA648_34990) | 111225..112592 | - | 1368 | WP_283054771.1 | type IV secretion system protein VirB10 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..212457 | 212457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10583.03 Da Isoelectric Point: 5.6864
>T276503 WP_104825436.1 NZ_CP121655:107530-107823 [Rhizobium sp. CB3171]
MKLIWSAFALADRDGIFTHIEADNPAAAASVDERIAAAARRLRDFPESGRPGRIAGTRELVITGTPYIAAYVVTETAVRI
LRVLHGAQQWPEALPED
MKLIWSAFALADRDGIFTHIEADNPAAAASVDERIAAAARRLRDFPESGRPGRIAGTRELVITGTPYIAAYVVTETAVRI
LRVLHGAQQWPEALPED
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|