Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4027..4632 | Replicon | plasmid pCB3171_3 |
Accession | NZ_CP121655 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QA648_RS34445 | Protein ID | WP_283054928.1 |
Coordinates | 4336..4632 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QA648_RS34440 | Protein ID | WP_283054868.1 |
Coordinates | 4027..4332 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS34420 (QA648_34420) | 1..1197 | + | 1197 | WP_283054863.1 | plasmid partitioning protein RepA | - |
QA648_RS34425 (QA648_34425) | 1201..2211 | + | 1011 | WP_283054865.1 | plasmid partitioning protein RepB | - |
QA648_RS34430 (QA648_34430) | 2366..3586 | + | 1221 | WP_283054866.1 | plasmid replication protein RepC | - |
QA648_RS34435 (QA648_34435) | 3654..3899 | + | 246 | WP_283054867.1 | helix-turn-helix transcriptional regulator | - |
QA648_RS34440 (QA648_34440) | 4027..4332 | - | 306 | WP_283054868.1 | putative addiction module antidote protein | Antitoxin |
QA648_RS34445 (QA648_34445) | 4336..4632 | - | 297 | WP_283054928.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA648_RS34450 (QA648_34450) | 4833..5750 | - | 918 | WP_283054929.1 | recombinase family protein | - |
QA648_RS34455 (QA648_34455) | 6156..6540 | - | 385 | Protein_7 | IS630 family transposase | - |
QA648_RS34460 (QA648_34460) | 6680..7264 | - | 585 | WP_283054869.1 | TetR/AcrR family transcriptional regulator | - |
QA648_RS34465 (QA648_34465) | 7953..8702 | + | 750 | WP_283054930.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..212457 | 212457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11047.80 Da Isoelectric Point: 10.4457
>T276502 WP_283054928.1 NZ_CP121655:c4632-4336 [Rhizobium sp. CB3171]
MFSIRETVEFSNWMLRLRDDRAKARIGQRIMRLASGNAGDVKPVGEGVSELRINYGPGYRVYFVREGSIMIVLLCGGDKK
TQSRDIERAKALANALKE
MFSIRETVEFSNWMLRLRDDRAKARIGQRIMRLASGNAGDVKPVGEGVSELRINYGPGYRVYFVREGSIMIVLLCGGDKK
TQSRDIERAKALANALKE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|