Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2735900..2736669 | Replicon | plasmid pCB3171_1 |
Accession | NZ_CP121653 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QA648_RS31575 | Protein ID | WP_283052914.1 |
Coordinates | 2735900..2736394 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | QA648_RS31580 | Protein ID | WP_283054321.1 |
Coordinates | 2736391..2736669 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS31565 (QA648_31565) | 2732561..2734186 | - | 1626 | WP_283052912.1 | winged helix-turn-helix domain-containing protein | - |
QA648_RS31570 (QA648_31570) | 2734488..2735414 | + | 927 | WP_283052913.1 | hypothetical protein | - |
QA648_RS31575 (QA648_31575) | 2735900..2736394 | - | 495 | WP_283052914.1 | GNAT family N-acetyltransferase | Toxin |
QA648_RS31580 (QA648_31580) | 2736391..2736669 | - | 279 | WP_283054321.1 | DUF1778 domain-containing protein | Antitoxin |
QA648_RS31585 (QA648_31585) | 2736753..2737190 | + | 438 | WP_283052916.1 | curlin | - |
QA648_RS31590 (QA648_31590) | 2737256..2737654 | + | 399 | WP_283052918.1 | curli-like amyloid fiber formation chaperone CsgH | - |
QA648_RS31595 (QA648_31595) | 2737829..2738242 | + | 414 | WP_283052920.1 | curlin | - |
QA648_RS31600 (QA648_31600) | 2738737..2740083 | - | 1347 | WP_283052921.1 | FAD-binding oxidoreductase | - |
QA648_RS31605 (QA648_31605) | 2740080..2741597 | - | 1518 | WP_260304528.1 | aldehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | katA / ddhA / icl | 1..2831118 | 2831118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17710.25 Da Isoelectric Point: 8.0293
>T276500 WP_283052914.1 NZ_CP121653:c2736394-2735900 [Rhizobium sp. CB3171]
VTLSAPAPLADHHELAEFNSGVPELDDWLRRRARSNQAGGARTFVVCEGSRVIAYYALASGAVRQPEAPGRFRRNMPDPI
PVAVLGRLAIDQSYQGRGFGRALVRDAGLRLLNAAEILGIRGVLVPAISDDARAFYEAVGFLSFPSDPMMRMVGLPDLNN
ALNP
VTLSAPAPLADHHELAEFNSGVPELDDWLRRRARSNQAGGARTFVVCEGSRVIAYYALASGAVRQPEAPGRFRRNMPDPI
PVAVLGRLAIDQSYQGRGFGRALVRDAGLRLLNAAEILGIRGVLVPAISDDARAFYEAVGFLSFPSDPMMRMVGLPDLNN
ALNP
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|