Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 1359079..1359761 | Replicon | plasmid pCB3171_1 |
| Accession | NZ_CP121653 | ||
| Organism | Rhizobium sp. CB3171 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA648_RS25610 | Protein ID | WP_283054192.1 |
| Coordinates | 1359339..1359761 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QA648_RS25605 | Protein ID | WP_104826582.1 |
| Coordinates | 1359079..1359342 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA648_RS25590 (QA648_25590) | 1354164..1354880 | - | 717 | WP_104826585.1 | GntR family transcriptional regulator | - |
| QA648_RS25595 (QA648_25595) | 1355482..1357755 | + | 2274 | WP_283054190.1 | cation:proton antiporter | - |
| QA648_RS25600 (QA648_25600) | 1357866..1358966 | + | 1101 | WP_283054191.1 | YihY/virulence factor BrkB family protein | - |
| QA648_RS25605 (QA648_25605) | 1359079..1359342 | + | 264 | WP_104826582.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QA648_RS25610 (QA648_25610) | 1359339..1359761 | + | 423 | WP_283054192.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA648_RS25615 (QA648_25615) | 1359842..1361917 | - | 2076 | WP_283054193.1 | glycogen debranching protein GlgX | - |
| QA648_RS25620 (QA648_25620) | 1362007..1364493 | - | 2487 | WP_283054270.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | katA / ddhA / icl | 1..2831118 | 2831118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15561.89 Da Isoelectric Point: 5.6799
>T276499 WP_283054192.1 NZ_CP121653:1359339-1359761 [Rhizobium sp. CB3171]
VRLLLDTNVLSEVTRPRPDAHVLKWLDGLDEDRSFISVVSIAEIRRGVALMDSGRKRDALTEWLAQDLPQRFEHRVLPVN
EPVAVAWGDLMGLAKRNGRGLSSMDGLIAATAIAHNLALATRNIRDFEGFGIELVDPWVV
VRLLLDTNVLSEVTRPRPDAHVLKWLDGLDEDRSFISVVSIAEIRRGVALMDSGRKRDALTEWLAQDLPQRFEHRVLPVN
EPVAVAWGDLMGLAKRNGRGLSSMDGLIAATAIAHNLALATRNIRDFEGFGIELVDPWVV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|