Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3955064..3955707 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA648_RS19250 | Protein ID | WP_283048779.1 |
Coordinates | 3955064..3955468 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA648_RS19255 | Protein ID | WP_104821787.1 |
Coordinates | 3955465..3955707 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS19215 (QA648_19215) | 3950161..3951066 | + | 906 | WP_283048768.1 | LysR family transcriptional regulator | - |
QA648_RS19220 (QA648_19220) | 3951067..3951942 | - | 876 | WP_104821780.1 | LysR family transcriptional regulator | - |
QA648_RS19225 (QA648_19225) | 3952039..3953322 | + | 1284 | WP_283048771.1 | MFS transporter | - |
QA648_RS19230 (QA648_19230) | 3953345..3953731 | + | 387 | WP_283048773.1 | VOC family protein | - |
QA648_RS19235 (QA648_19235) | 3953850..3954191 | + | 342 | WP_283048775.1 | metalloregulator ArsR/SmtB family transcription factor | - |
QA648_RS19240 (QA648_19240) | 3954175..3954657 | + | 483 | WP_283048777.1 | SRPBCC domain-containing protein | - |
QA648_RS19245 (QA648_19245) | 3954663..3955067 | + | 405 | WP_104821785.1 | GFA family protein | - |
QA648_RS19250 (QA648_19250) | 3955064..3955468 | - | 405 | WP_283048779.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QA648_RS19255 (QA648_19255) | 3955465..3955707 | - | 243 | WP_104821787.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QA648_RS19260 (QA648_19260) | 3955773..3956447 | - | 675 | WP_104821788.1 | hypothetical protein | - |
QA648_RS19265 (QA648_19265) | 3956574..3958235 | - | 1662 | WP_283048782.1 | urocanate hydratase | - |
QA648_RS19270 (QA648_19270) | 3958278..3958607 | - | 330 | WP_283048784.1 | TfoX/Sxy family protein | - |
QA648_RS19275 (QA648_19275) | 3958626..3959726 | - | 1101 | WP_283048785.1 | DUF917 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15083.21 Da Isoelectric Point: 6.4885
>T276498 WP_283048779.1 NZ_CP121652:c3955468-3955064 [Rhizobium sp. CB3171]
VKYLLDSNAVIALMKGHTGFVSELRRHKPQDFAISAIVAHELFYGAYKGQRVADNLVRVDALQFETLDFDREDARVVGEI
RANLASLGTPIGAYDVLIAGQAVARDLILITRNVREFERVHKLRFEDWESLPSS
VKYLLDSNAVIALMKGHTGFVSELRRHKPQDFAISAIVAHELFYGAYKGQRVADNLVRVDALQFETLDFDREDARVVGEI
RANLASLGTPIGAYDVLIAGQAVARDLILITRNVREFERVHKLRFEDWESLPSS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|