Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 3201376..3201983 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QA648_RS15640 | Protein ID | WP_283047908.1 |
Coordinates | 3201376..3201630 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QA648_RS15645 | Protein ID | WP_283047909.1 |
Coordinates | 3201627..3201983 (+) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS15610 (QA648_15610) | 3196575..3197231 | - | 657 | WP_104824704.1 | response regulator transcription factor | - |
QA648_RS15615 (QA648_15615) | 3197471..3197755 | + | 285 | WP_104824705.1 | hypothetical protein | - |
QA648_RS15620 (QA648_15620) | 3197819..3199234 | - | 1416 | WP_283047905.1 | PLP-dependent aminotransferase family protein | - |
QA648_RS15625 (QA648_15625) | 3199341..3200204 | + | 864 | WP_283047906.1 | DMT family transporter | - |
QA648_RS15630 (QA648_15630) | 3200287..3200751 | + | 465 | WP_104824707.1 | nuclear transport factor 2 family protein | - |
QA648_RS15635 (QA648_15635) | 3200756..3201319 | + | 564 | WP_283047907.1 | TetR/AcrR family transcriptional regulator | - |
QA648_RS15640 (QA648_15640) | 3201376..3201630 | + | 255 | WP_283047908.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QA648_RS15645 (QA648_15645) | 3201627..3201983 | + | 357 | WP_283047909.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QA648_RS15650 (QA648_15650) | 3202055..3202618 | - | 564 | WP_283047910.1 | hypothetical protein | - |
QA648_RS15655 (QA648_15655) | 3202735..3203370 | + | 636 | WP_283047912.1 | TetR-like C-terminal domain-containing protein | - |
QA648_RS15660 (QA648_15660) | 3203528..3204853 | + | 1326 | WP_283047914.1 | glucoamylase family protein | - |
QA648_RS15665 (QA648_15665) | 3204904..3205893 | - | 990 | WP_283051362.1 | Ldh family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9293.58 Da Isoelectric Point: 9.9233
>T276496 WP_283047908.1 NZ_CP121652:3201376-3201630 [Rhizobium sp. CB3171]
MNSKQIRTLAAVFRNPVSGTIDWADIESLLIATGANIIEGSGSRVKFEKDGAVASFHRPHPDKEAKRYQVRDAREFLIQI
GVTP
MNSKQIRTLAAVFRNPVSGTIDWADIESLLIATGANIIEGSGSRVKFEKDGAVASFHRPHPDKEAKRYQVRDAREFLIQI
GVTP
Download Length: 255 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13207.82 Da Isoelectric Point: 6.3331
>AT276496 WP_283047909.1 NZ_CP121652:3201627-3201983 [Rhizobium sp. CB3171]
VNTMSYKSYHARIEYDDEDEIFFGKIAGISDVIGFHAESVAELKSAFHEAVDDYIATCHRIGKEPQKPYSGKMMFRVDPE
VHRRAAMAAELSGKSLNQWAEEALEKAAKQAGQTRRAG
VNTMSYKSYHARIEYDDEDEIFFGKIAGISDVIGFHAESVAELKSAFHEAVDDYIATCHRIGKEPQKPYSGKMMFRVDPE
VHRRAAMAAELSGKSLNQWAEEALEKAAKQAGQTRRAG
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|