Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/Phd-VapC |
Location | 2407979..2408643 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA648_RS11835 | Protein ID | WP_104824050.1 |
Coordinates | 2407979..2408233 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA648_RS11840 | Protein ID | WP_260303102.1 |
Coordinates | 2408233..2408643 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS11805 (QA648_11805) | 2403491..2404072 | + | 582 | WP_283047072.1 | NAD(P)H-dependent oxidoreductase | - |
QA648_RS11810 (QA648_11810) | 2404117..2404506 | - | 390 | WP_283047073.1 | RidA family protein | - |
QA648_RS11815 (QA648_11815) | 2404619..2405515 | - | 897 | WP_283047075.1 | DMT family transporter | - |
QA648_RS11820 (QA648_11820) | 2405715..2406161 | + | 447 | WP_283047077.1 | hypothetical protein | - |
QA648_RS11825 (QA648_11825) | 2406183..2406800 | - | 618 | WP_104824048.1 | alpha/beta hydrolase | - |
QA648_RS11830 (QA648_11830) | 2406814..2407746 | - | 933 | WP_104824049.1 | VOC family protein | - |
QA648_RS11835 (QA648_11835) | 2407979..2408233 | + | 255 | WP_104824050.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Toxin |
QA648_RS11840 (QA648_11840) | 2408233..2408643 | + | 411 | WP_260303102.1 | type II toxin-antitoxin system VapC family toxin | Antitoxin |
QA648_RS11845 (QA648_11845) | 2408637..2409338 | - | 702 | WP_283047081.1 | uracil-DNA glycosylase | - |
QA648_RS11850 (QA648_11850) | 2409428..2410069 | - | 642 | WP_283051315.1 | septation protein IspZ | - |
QA648_RS11855 (QA648_11855) | 2410157..2412604 | - | 2448 | WP_283047083.1 | FAD-dependent oxidoreductase | - |
QA648_RS11860 (QA648_11860) | 2412614..2413492 | - | 879 | WP_283047085.1 | choline kinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9216.26 Da Isoelectric Point: 4.4165
>T276494 WP_104824050.1 NZ_CP121652:2407979-2408233 [Rhizobium sp. CB3171]
MDWPLQDAKNQFSKVVQKARSEGPQTVTLRGERAVVVLSAEDYDALRAGKPSLVDDLLSGPAWDDELADAVTTRDKTPSR
DVAF
MDWPLQDAKNQFSKVVQKARSEGPQTVTLRGERAVVVLSAEDYDALRAGKPSLVDDLLSGPAWDDELADAVTTRDKTPSR
DVAF
Download Length: 255 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15182.37 Da Isoelectric Point: 6.4860
>AT276494 WP_260303102.1 NZ_CP121652:2408233-2408643 [Rhizobium sp. CB3171]
MYLIDTNIISEARRGTIEAISWLRIADPSTVYLSVITLGEVMRGIALKRRTDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRISALRPRGDADGLIAATAIVHDLIIVTRNVSDFDDAGVSVINPWDQASY
MYLIDTNIISEARRGTIEAISWLRIADPSTVYLSVITLGEVMRGIALKRRTDPRAAAHLEEWLRKLRHDHSGRILPITDQ
IAVEWGRISALRPRGDADGLIAATAIVHDLIIVTRNVSDFDDAGVSVINPWDQASY
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|