Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 739236..739795 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QA648_RS03640 | Protein ID | WP_283049680.1 |
Coordinates | 739236..739601 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QA648_RS03645 | Protein ID | WP_104822467.1 |
Coordinates | 739598..739795 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS03620 (QA648_03620) | 734273..735517 | - | 1245 | WP_283049673.1 | efflux RND transporter periplasmic adaptor subunit | - |
QA648_RS03625 (QA648_03625) | 735949..736737 | - | 789 | WP_283049675.1 | SDR family oxidoreductase | - |
QA648_RS03630 (QA648_03630) | 737023..738687 | + | 1665 | WP_283049677.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
QA648_RS03635 (QA648_03635) | 738756..739220 | + | 465 | WP_283049678.1 | GNAT family N-acetyltransferase | - |
QA648_RS03640 (QA648_03640) | 739236..739601 | - | 366 | WP_283049680.1 | PIN domain-containing protein | Toxin |
QA648_RS03645 (QA648_03645) | 739598..739795 | - | 198 | WP_104822467.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QA648_RS03650 (QA648_03650) | 739898..740800 | - | 903 | WP_283049682.1 | DMT family transporter | - |
QA648_RS03655 (QA648_03655) | 740946..741419 | + | 474 | WP_104822469.1 | Lrp/AsnC family transcriptional regulator | - |
QA648_RS03660 (QA648_03660) | 741470..742843 | - | 1374 | WP_104822470.1 | magnesium transporter | - |
QA648_RS03665 (QA648_03665) | 743042..743230 | - | 189 | WP_283049683.1 | hypothetical protein | - |
QA648_RS03670 (QA648_03670) | 743241..744449 | - | 1209 | WP_283051205.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13770.07 Da Isoelectric Point: 8.4792
>T276492 WP_283049680.1 NZ_CP121652:c739601-739236 [Rhizobium sp. CB3171]
MILVDTSIWIDHFHSLDAKLQSLLEQKQVLIHPVVIGEISLGNLRQYDLVMRSLSRLYQISKAPDDDVLYFIRSNRLQGM
GIGYVDAHLAAAAILTPGTYLWTRDKRLQRVAENLRIAALL
MILVDTSIWIDHFHSLDAKLQSLLEQKQVLIHPVVIGEISLGNLRQYDLVMRSLSRLYQISKAPDDDVLYFIRSNRLQGM
GIGYVDAHLAAAAILTPGTYLWTRDKRLQRVAENLRIAALL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|