Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 606001..606578 | Replicon | chromosome |
Accession | NZ_CP121652 | ||
Organism | Rhizobium sp. CB3171 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QA648_RS02985 | Protein ID | WP_104822357.1 |
Coordinates | 606288..606578 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | QA648_RS02980 | Protein ID | WP_104822356.1 |
Coordinates | 606001..606285 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA648_RS02965 (QA648_02965) | 602859..603857 | + | 999 | WP_283049524.1 | NAD(P)H-quinone oxidoreductase | - |
QA648_RS02970 (QA648_02970) | 603838..605265 | - | 1428 | WP_283049525.1 | MFS transporter | - |
QA648_RS02975 (QA648_02975) | 605367..605990 | + | 624 | WP_283049526.1 | MarR family transcriptional regulator | - |
QA648_RS02980 (QA648_02980) | 606001..606285 | - | 285 | WP_104822356.1 | putative addiction module antidote protein | Antitoxin |
QA648_RS02985 (QA648_02985) | 606288..606578 | - | 291 | WP_104822357.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QA648_RS02990 (QA648_02990) | 606758..607765 | + | 1008 | WP_283049528.1 | asparaginase | - |
QA648_RS02995 (QA648_02995) | 607812..608573 | - | 762 | WP_283049530.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QA648_RS03000 (QA648_03000) | 608696..609052 | + | 357 | WP_283049532.1 | DUF4406 domain-containing protein | - |
QA648_RS03005 (QA648_03005) | 609189..609809 | + | 621 | WP_283049534.1 | glutathione S-transferase N-terminal domain-containing protein | - |
QA648_RS03010 (QA648_03010) | 609810..610166 | - | 357 | WP_283051197.1 | MmcQ/YjbR family DNA-binding protein | - |
QA648_RS03015 (QA648_03015) | 610285..610470 | - | 186 | WP_283049536.1 | hypothetical protein | - |
QA648_RS03020 (QA648_03020) | 610618..611514 | + | 897 | WP_104822362.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10666.35 Da Isoelectric Point: 9.7931
>T276491 WP_104822357.1 NZ_CP121652:c606578-606288 [Rhizobium sp. CB3171]
MIEIRQTAEFAEWLGKIKDINAVARIQVRIRRLSLGNPGDVKPVGEGISELRIDYGPGYRLYYHKRGQELVLLLCGGDKS
TQNADIAKAKALAKEA
MIEIRQTAEFAEWLGKIKDINAVARIQVRIRRLSLGNPGDVKPVGEGISELRIDYGPGYRLYYHKRGQELVLLLCGGDKS
TQNADIAKAKALAKEA
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|