Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | rlegTA/- |
| Location | 5470815..5471772 | Replicon | chromosome |
| Accession | NZ_CP121647 | ||
| Organism | Bradyrhizobium sp. CB3481 | ||
Toxin (Protein)
| Gene name | rlegT | Uniprot ID | - |
| Locus tag | QA643_RS26670 | Protein ID | WP_283028739.1 |
| Coordinates | 5470815..5471192 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | rlegA | Uniprot ID | - |
| Locus tag | QA643_RS26675 | Protein ID | WP_283028740.1 |
| Coordinates | 5471185..5471772 (-) | Length | 196 a.a. |
Genomic Context
Location: 5471909..5472706 (798 bp)
Type: Others
Protein ID: WP_283028741.1
Type: Others
Protein ID: WP_283028741.1
Location: 5472844..5474967 (2124 bp)
Type: Others
Protein ID: WP_283034939.1
Type: Others
Protein ID: WP_283034939.1
Location: 5474972..5475982 (1011 bp)
Type: Others
Protein ID: WP_283028742.1
Type: Others
Protein ID: WP_283028742.1
Location: 5468392..5468709 (318 bp)
Type: Others
Protein ID: WP_283028736.1
Type: Others
Protein ID: WP_283028736.1
Location: 5468986..5469861 (876 bp)
Type: Others
Protein ID: WP_283028737.1
Type: Others
Protein ID: WP_283028737.1
Location: 5469871..5470806 (936 bp)
Type: Others
Protein ID: WP_283028738.1
Type: Others
Protein ID: WP_283028738.1
Location: 5470815..5471192 (378 bp)
Type: Toxin
Protein ID: WP_283028739.1
Type: Toxin
Protein ID: WP_283028739.1
Location: 5471185..5471772 (588 bp)
Type: Antitoxin
Protein ID: WP_283028740.1
Type: Antitoxin
Protein ID: WP_283028740.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA643_RS26655 (QA643_26655) | 5468392..5468709 | - | 318 | WP_283028736.1 | hypothetical protein | - |
| QA643_RS26660 (QA643_26660) | 5468986..5469861 | - | 876 | WP_283028737.1 | DUF2726 domain-containing protein | - |
| QA643_RS26665 (QA643_26665) | 5469871..5470806 | - | 936 | WP_283028738.1 | hypothetical protein | - |
| QA643_RS26670 (QA643_26670) | 5470815..5471192 | - | 378 | WP_283028739.1 | hypothetical protein | Toxin |
| QA643_RS26675 (QA643_26675) | 5471185..5471772 | - | 588 | WP_283028740.1 | transcriptional regulator | Antitoxin |
| QA643_RS26680 (QA643_26680) | 5471909..5472706 | + | 798 | WP_283028741.1 | hypothetical protein | - |
| QA643_RS26685 (QA643_26685) | 5472844..5474967 | + | 2124 | WP_283034939.1 | AAA family ATPase | - |
| QA643_RS26690 (QA643_26690) | 5474972..5475982 | + | 1011 | WP_283028742.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5464820..5485009 | 20189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14237.32 Da Isoelectric Point: 10.0382
>T276483 WP_283028739.1 NZ_CP121647:c5471192-5470815 [Bradyrhizobium sp. CB3481]
MRKPLKNVGASVRARLLNLSKERNEPFELLLTQYALERLLSRTYEFKDDRLARAIRATFDRRKTQIPTEQPDALSEAFAN
DPTKIQQWTAFIQDVAIDPGPLNGVVETLATFLMPHAETARNLKG
MRKPLKNVGASVRARLLNLSKERNEPFELLLTQYALERLLSRTYEFKDDRLARAIRATFDRRKTQIPTEQPDALSEAFAN
DPTKIQQWTAFIQDVAIDPGPLNGVVETLATFLMPHAETARNLKG
Download Length: 378 bp
Antitoxin
Download Length: 196 a.a. Molecular weight: 21865.43 Da Isoelectric Point: 9.9361
>AT276483 WP_283028740.1 NZ_CP121647:c5471772-5471185 [Bradyrhizobium sp. CB3481]
MMRLSEFIEEGITSATVSRMEQKGALNQLSRGLYQLPDAPLEANHSLAVAAKLVPKGVICYDSALAFHELTDRIPPYVWM
AIGPRDWRPKITRPHIQIMRFGPKEFDKGIERHMIEGVSVPIYTSAKTIVDLFKSGQRQKAFYNASTGLAHATQAMKDAL
RMRKATPSEIAKYAVEAGIWEKIVQPRLETLTINA
MMRLSEFIEEGITSATVSRMEQKGALNQLSRGLYQLPDAPLEANHSLAVAAKLVPKGVICYDSALAFHELTDRIPPYVWM
AIGPRDWRPKITRPHIQIMRFGPKEFDKGIERHMIEGVSVPIYTSAKTIVDLFKSGQRQKAFYNASTGLAHATQAMKDAL
RMRKATPSEIAKYAVEAGIWEKIVQPRLETLTINA
Download Length: 588 bp