Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 2465981..2466684 | Replicon | chromosome |
| Accession | NZ_CP121644 | ||
| Organism | Bradyrhizobium barranii strain CC1502 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QA633_RS11270 | Protein ID | WP_063985190.1 |
| Coordinates | 2465981..2466406 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8T5VAC8 |
| Locus tag | QA633_RS11275 | Protein ID | WP_028148610.1 |
| Coordinates | 2466403..2466684 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA633_RS11240 (QA633_11240) | 2461913..2462323 | + | 411 | WP_063985193.1 | acyl-CoA thioesterase | - |
| QA633_RS11245 (QA633_11245) | 2462544..2462735 | + | 192 | WP_028134810.1 | hypothetical protein | - |
| QA633_RS11250 (QA633_11250) | 2463001..2463396 | - | 396 | WP_155795382.1 | nuclear transport factor 2 family protein | - |
| QA633_RS11255 (QA633_11255) | 2463716..2464183 | - | 468 | WP_231144343.1 | nuclear transport factor 2 family protein | - |
| QA633_RS11260 (QA633_11260) | 2464338..2465036 | + | 699 | WP_063985192.1 | HAD-IA family hydrolase | - |
| QA633_RS11265 (QA633_11265) | 2465128..2465976 | + | 849 | WP_063985191.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QA633_RS11270 (QA633_11270) | 2465981..2466406 | - | 426 | WP_063985190.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QA633_RS11275 (QA633_11275) | 2466403..2466684 | - | 282 | WP_028148610.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QA633_RS11280 (QA633_11280) | 2466914..2468464 | + | 1551 | WP_063985189.1 | glycerol-3-phosphate dehydrogenase | - |
| QA633_RS11285 (QA633_11285) | 2468461..2469537 | + | 1077 | WP_063985188.1 | ABC transporter ATP-binding protein | - |
| QA633_RS11290 (QA633_11290) | 2469552..2470637 | + | 1086 | WP_063985187.1 | ABC transporter ATP-binding protein | - |
| QA633_RS11295 (QA633_11295) | 2470637..2471611 | + | 975 | WP_063985186.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15471.74 Da Isoelectric Point: 5.1538
>T276481 WP_063985190.1 NZ_CP121644:c2466406-2465981 [Bradyrhizobium barranii]
VNLLLDTNVLSEVQRPAPSPKVLAWLDTVDEDRTFISVASIAELRRGIALLDDGRRRAALVAWLAHDLPARFAQRILPID
HAVAERWGDLMAQSRRNGVALSVMDGFFAATALANDLTLVTRNVKDFAAFGVPLLDPWSDA
VNLLLDTNVLSEVQRPAPSPKVLAWLDTVDEDRTFISVASIAELRRGIALLDDGRRRAALVAWLAHDLPARFAQRILPID
HAVAERWGDLMAQSRRNGVALSVMDGFFAATALANDLTLVTRNVKDFAAFGVPLLDPWSDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|